product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
Cytokeratin 7 Antibody - BSA Free
catalog :
NBP1-88080
quantity :
0.1 ml (also 25 ul)
price :
559 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section
more info or order :
citations: 6
Published Application/Species/Sample/DilutionReference
  • immunohistochemistry - paraffin section; mouse; 1:500; loading ...; fig 6d
Quach C, Song Y, Guo H, Li S, Maazi H, Fung M, et al. A truncating mutation in the autophagy gene UVRAG drives inflammation and tumorigenesis in mice. Nat Commun. 2019;10:5681 pubmed publisher
Baier F, Sánchez Taltavull D, Yarahmadov T, Castellà C, Jebbawi F, Keogh A, et al. Loss of Claudin-3 Impairs Hepatic Metabolism, Biliary Barrier Function, and Cell Proliferation in the Murine Liver. Cell Mol Gastroenterol Hepatol. 2021;12:745-767 pubmed publisher
Thomas R, Henson A, Gerrish A, Jones L, Williams J, Kidd E. Decreasing the expression of PICALM reduces endocytosis and the activity of β-secretase: implications for Alzheimer's disease. BMC Neurosci. 2016;17:50 pubmed publisher
Tsai Teng T, Chin Chu C, Li Ya L, Wan Ping C, Chung Kuang L, Chien Chang S, et al. Erinacine A-enriched Hericium erinaceus mycelium ameliorates Alzheimer's disease-related pathologies in APPswe/PS1dE9 transgenic mice. J Biomed Sci. 2016;23:49 pubmed publisher
Mercer J, Argus J, Crabtree D, KEENAN M, Wilks M, Chi J, et al. Modulation of PICALM Levels Perturbs Cellular Cholesterol Homeostasis. PLoS ONE. 2015;10:e0129776 pubmed publisher
Zhao Z, Sagare A, Ma Q, Halliday M, Kong P, Kisler K, et al. Central role for PICALM in amyloid-β blood-brain barrier transcytosis and clearance. Nat Neurosci. 2015;18:978-87 pubmed publisher
product information
brand :
Novus
catalog number base :
NBP1-88080
SKU :
NBP1-88080
product name :
Cytokeratin 7 Antibody - BSA Free
units size :
0.1 ml (also 25 ul)
description :
The Cytokeratin 7 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to Cytokeratin 7. This antibody reacts with human,mouse,rat. The Cytokeratin 7 Antibody - BSA Free has been validated for the following applications: IF/IHC,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Simple Western.
target :
Cytokeratin 7
category :
Primary Antibodies
buffer :
PBS (pH 7.2) and 40% Glycerol
clonality :
Polyclonal
conjugate :
Unconjugated
all_available conjugate :
Unconjugated
host :
Rabbit
immunogen :
RQEESEQIKTLNNKFASFIDKVRFLEQQNKLLETKWTLL
QEQKSAKSSRLPDIFEAQIAGLRGQLEALQVDGGRLEAE
LRSMQDVVEDFKNKYEDEINRRTAAENEFVVLKKDVD
This antibody was developed against Recombinant Protein corresponding to amino acids:
isotype :
IgG
purity :
Immunogen affinity purified
species :
Human,Mouse,Rat
specificity :
It recognizes an intermediate filament protein (IFP) of 55kDa, which is identified as cytokeratin 7
gene symbol :
KRT7
Antibody validation :
Orthogonal Validation
top caption :
Immunohistochemistry-Paraffin: Cytokeratin 7 Antibody [NBP1-88080]
accessionNumbers :
P08729
applications :
IF/IHC,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Simple Western
USD :
559 USD
alt names :
CK7, CK-7, cytokeratin 7, Cytokeratin-7, K2C7, K7keratin, 55K type II cytoskeletal, keratin 7, keratin, type II cytoskeletal 7, keratin-7, MGC129731, MGC3625, Sarcolectin, SCLkeratin, simple epithelial type I, K7, type II mesothelial keratin K7, Type-II keratin Kb7
storage :
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
more info or order :
company information
Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com
3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.