Cytokeratin 7 Antibody - BSA Free | Novus Biologicals NBP1-88080 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

Cytokeratin 7 Antibody - BSA Free

catalog :

NBP1-88080

quantity :

0.1 ml (also 25 ul)

price :

559 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 6

Published Application/Species/Sample/Dilution	Reference
immunohistochemistry - paraffin section; mouse; 1:500; loading ...; fig 6d	Quach C, Song Y, Guo H, Li S, Maazi H, Fung M, et al. A truncating mutation in the autophagy gene UVRAG drives inflammation and tumorigenesis in mice. Nat Commun. 2019;10:5681 pubmed publisher
	Baier F, Sánchez Taltavull D, Yarahmadov T, Castellà C, Jebbawi F, Keogh A, et al. Loss of Claudin-3 Impairs Hepatic Metabolism, Biliary Barrier Function, and Cell Proliferation in the Murine Liver. Cell Mol Gastroenterol Hepatol. 2021;12:745-767 pubmed publisher
	Thomas R, Henson A, Gerrish A, Jones L, Williams J, Kidd E. Decreasing the expression of PICALM reduces endocytosis and the activity of β-secretase: implications for Alzheimer's disease. BMC Neurosci. 2016;17:50 pubmed publisher
	Tsai Teng T, Chin Chu C, Li Ya L, Wan Ping C, Chung Kuang L, Chien Chang S, et al. Erinacine A-enriched Hericium erinaceus mycelium ameliorates Alzheimer's disease-related pathologies in APPswe/PS1dE9 transgenic mice. J Biomed Sci. 2016;23:49 pubmed publisher
	Mercer J, Argus J, Crabtree D, KEENAN M, Wilks M, Chi J, et al. Modulation of PICALM Levels Perturbs Cellular Cholesterol Homeostasis. PLoS ONE. 2015;10:e0129776 pubmed publisher
	Zhao Z, Sagare A, Ma Q, Halliday M, Kong P, Kisler K, et al. Central role for PICALM in amyloid-Î² blood-brain barrier transcytosis and clearance. Nat Neurosci. 2015;18:978-87 pubmed publisher

product information

master code :

NBP1-88080

SKU :

NBP1-88080

product name :

Cytokeratin 7 Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The Cytokeratin 7 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to Cytokeratin 7. This antibody reacts with human,mouse,rat. The Cytokeratin 7 Antibody - BSA Free has been validated for the following applications: IF/IHC,Western Blot,Immunohistochemistry,Immunohistochemistry-Paraffin,Simple Western.

target :

Cytokeratin 7

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

RQEESEQIKTLNNKFASFIDKVRFLEQQNKLLETKWTLL
QEQKSAKSSRLPDIFEAQIAGLRGQLEALQVDGGRLEAE
LRSMQDVVEDFKNKYEDEINRRTAAENEFVVLKKDVD
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human,Mouse,Rat

gene symbol :

KRT7

Antibody validation :

Orthogonal Validation

accessionNumbers :

P08729

applications :

IF/IHC,Western Blot,Immunohistochemistry,Immunohistochemistry-Paraffin,Simple Western

USD :

559 USD

alt names :

CK7, CK-7, cytokeratin 7, Cytokeratin-7, K2C7, K7keratin, 55K type II cytoskeletal, keratin 7, keratin, type II cytoskeletal 7, keratin-7, MGC129731, MGC3625, Sarcolectin, SCLkeratin, simple epithelial type I, K7, type II mesothelial keratin K7, Type-II keratin Kb7

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage