FoxJ1/HFH4 Antibody - BSA Free | Novus Biologicals NBP1-87928 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

FoxJ1/HFH4 Antibody - BSA Free

catalog :

NBP1-87928

quantity :

0.1 ml (also 25 ul)

price :

559 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section, immunohistochemistry - frozen section

more info or order :

Novus Biologicals product webpage

citations: 7

Reference
Chapman F, Pour S, Wieczorek R, Trelles Sticken E, Budde J, R xf6 wer K, et al. Twenty-eight day repeated exposure of human 3D bronchial epithelial model to heated tobacco aerosols indicates decreased toxicological responses compared to cigarette smoke. Front Toxicol. 2023;5:1076752 pubmed publisher
Michelson D, Hase K, Kaisho T, Benoist C, Mathis D. Thymic epithelial cells co-opt lineage-defining transcription factors to eliminate autoreactive T cells. Cell. 2022;185:2542-2558.e18 pubmed publisher
Lehman N, Spassky N, Sak M, Webb A, Zumbar C, Usubalieva A, et al. Astroblastomas exhibit radial glia stem cell lineages and differential expression of imprinted and X-inactivation escape genes. Nat Commun. 2022;13:2083 pubmed publisher
Hong Y, Shan S, Gu Y, Huang H, Zhang Q, Han Y, et al. Malfunction of airway basal stem cells plays a crucial role in pathophysiology of tracheobronchopathia osteoplastica. Nat Commun. 2022;13:1309 pubmed publisher
Czekala L, Wieczorek R, Simms L, Yu F, Budde J, Trelles Sticken E, et al. Multi-endpoint analysis of human 3D airway epithelium following repeated exposure to whole electronic vapor product aerosol or cigarette smoke. Curr Res Toxicol. 2021;2:99-115 pubmed publisher
Håglin S, Berghard A, Bohm S. Increased Retinoic Acid Catabolism in Olfactory Sensory Neurons Activates Dormant Tissue-Specific Stem Cells and Accelerates Age-Related Metaplasia. J Neurosci. 2020;40:4116-4129 pubmed publisher
Wang Q, Bhattacharya S, Mereness J, Anderson C, Lillis J, Misra R, et al. A novel in vitro model of primary human pediatric lung epithelial cells. Pediatr Res. 2019;: pubmed publisher

product information

master code :

NBP1-87928

SKU :

NBP1-87928

product name :

FoxJ1/HFH4 Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The FoxJ1/HFH4 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to FoxJ1/HFH4. This antibody reacts with human,mouse. The FoxJ1/HFH4 Antibody - BSA Free has been validated for the following applications: IF/IHC,IHC-F,Immunohistochemistry,Western Blot,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry-Paraffin,Immunohistochemistry-Frozen.

target :

FoxJ1/HFH4

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

PREKDEPGKGGFWRIDPQYAERLLSGAFKKRRLPPVHIH
PAFARQAAQEPSAVPRAGPLTVNTEAQQLLREFEEATGE
AGWGAGEGRLGHKRKQPLPKRVAKVPRPPSTLLPTPEEQ
GELEPLKG
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human,Mouse

gene symbol :

FOXJ1

Antibody validation :

Orthogonal Validation

applications :

IF/IHC,IHC-F,Immunohistochemistry,Western Blot,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry-Paraffin,Immunohistochemistry-Frozen

USD :

559 USD

alt names :

FKHL13forkhead transcription factor HFH-4, forkhead box J1, forkhead-like 13, Forkhead-related protein FKHL13, Hepatocyte nuclear factor 3 forkhead homolog 4, HFH4fork head homologue 4, HFH-4forkhead box protein J1, MGC35202

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage