Myelin PLP Antibody - BSA Free | Novus Biologicals NBP1-87781 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

Myelin PLP Antibody - BSA Free

catalog :

NBP1-87781

quantity :

0.1 ml (also 25 ul)

price :

559 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 7

Reference
Cifuentes Diaz C, Canali G, Garcia M, Druart M, Manett T, Savariradjane M, et al. Differential impacts of Cntnap2 heterozygosity and Cntnap2 null homozygosity on axon and myelinated fiber development in mouse. Front Neurosci. 2023;17:1100121 pubmed publisher
Kornelius E, Tsou S, Chang C, Ho Y, Lin S, Chen W, et al. Liraglutide Attenuates Glucolipotoxicity-Induced RSC96 Schwann Cells' Inflammation and Dysfunction. Biomolecules. 2022;12: pubmed publisher
Gomez Pinedo U, Mat xed as Guiu J, Torre Fuentes L, Montero Escribano P, Hern xe1 ndez Lorenzo L, Pytel V, et al. Variant rs4149584 (R92Q) of the TNFRSF1A gene in patients with familial multiple sclerosis. Neurologia (Engl Ed). 2022;: pubmed publisher
Creighton B, Afriyie S, Ajit D, Casingal C, Voos K, Reger J, et al. Giant ankyrin-B mediates transduction of axon guidance and collateral branch pruning factor sema 3A. elife. 2021;10: pubmed publisher
Wu Z, Liu Y, Huang J, Huang Y, Fan L. MiR-206 inhibits epilepsy and seizure-induced brain injury by targeting CCL2. Cytotechnology. 2019;:809-818 pubmed publisher
Altieri P, Bertolotto M, Fabbi P, Sportelli E, Balbi M, Santini F, et al. Thrombin induces protease-activated receptor 1 signaling and activation of human atrial fibroblasts and dabigatran prevents these effects. Int J Cardiol. 2018;271:219-227 pubmed publisher
Li Q, Tsuneki M, Krauthammer M, Couture R, Schwartz M, Madri J. Modulation of Sox10, HIF-1Î±, Survivin, and YAP by Minocycline in the Treatment of Neurodevelopmental Handicaps following Hypoxic Insult. Am J Pathol. 2015;185:2364-78 pubmed publisher

product information

master code :

NBP1-87781

SKU :

NBP1-87781

product name :

Myelin PLP Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The Myelin PLP Antibody - BSA Free from Novus is a rabbit polyclonal antibody to Myelin PLP. This antibody reacts with human,mouse. The Myelin PLP Antibody - BSA Free has been validated for the following applications: Western Blot,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry,Immunohistochemistry-Paraffin.

target :

Myelin PLP

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

LLLAEGFYTTGAVRQIFGDYKTTICGKGLSATVTGGQKG
RGSRGQHQAHSLERVCHCLGKWLGHPDKFVGI
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human,Mouse

gene symbol :

PLP1

Antibody validation :

Orthogonal Validation

applications :

Western Blot,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry,Immunohistochemistry-Paraffin

USD :

559 USD

alt names :

HLD1, lipophilin, major myelin proteolipid protein, MMPL, myelin proteolipid protein, PLP, PLP/DM20, PMD, proteolipid protein 1, spastic paraplegia 2, uncomplicated, SPG2

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage