product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
Myosin VB Antibody - BSA Free
catalog :
NBP1-87746
quantity :
0.1 ml (also 25 ul)
price :
559 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section
more info or order :
citations: 17
Reference
Silverman J, Krystofiak E, Caplan L, Lau K, Tyska M. Organization of a cytoskeletal superstructure in the apical domain of intestinal tuft cells. J Cell Biol. 2024;223: pubmed publisher
Zaffagnini G, Cheng S, Salzer M, Pernaute B, Duran J, Irimia M, et al. Mouse oocytes sequester aggregated proteins in degradative super-organelles. Cell. 2024;187:1109-1126.e21 pubmed publisher
Gromova K, Thies E, Janiesch P, L xfc tzenkirchen F, Zhu Y, Stajano D, et al. The kinesin Kif21b binds myosin Va and mediates changes in actin dynamics underlying homeostatic synaptic downscaling. Cell Rep. 2023;42:112743 pubmed publisher
Zhao G, Liu S, Arun S, Renda F, Khodjakov A, Pellman D. A tubule-sheet continuum model for the mechanism of nuclear envelope assembly. Dev Cell. 2023;58:847-865.e10 pubmed publisher
Jun Y, Lee S, Ban B, Lee J, Gao F. Non-muscle MYH10/myosin IIB recruits ESCRT-III to participate in autophagosome closure to maintain neuronal homeostasis. Autophagy. 2023;19:2045-2061 pubmed publisher
Engevik K, Engevik M, Engevik A. Bioinformatics reveal elevated levels of Myosin Vb in uterine corpus endometrial carcinoma patients which correlates to increased cell metabolism and poor prognosis. PLoS ONE. 2023;18:e0280428 pubmed publisher
Ahsan M, Dos Reis D, Barbieri A, Sumigray K, Nottoli T, SALAS P, et al. Loss of Serum Glucocorticoid-Inducible Kinase 1 SGK1 Worsens Malabsorption and Diarrhea in Microvillus Inclusion Disease (MVID). J Clin Med. 2022;11: pubmed publisher
Sakai T, Choo Y, Sato O, Ikebe R, Jeffers A, Idell S, et al. Myo5b Transports Fibronectin-Containing Vesicles and Facilitates FN1 Secretion from Human Pleural Mesothelial Cells. Int J Mol Sci. 2022;23: pubmed publisher
Li Q, Zhou Z, Sun Y, Sun C, Klappe K, Van IJzendoorn S. A Functional Relationship Between UNC45A and MYO5B Connects Two Rare Diseases With Shared Enteropathy. Cell Mol Gastroenterol Hepatol. 2022;14:295-310 pubmed publisher
Leijnse N, Barooji Y, Arastoo M, Sønder S, Verhagen B, Wullkopf L, et al. Filopodia rotate and coil by actively generating twist in their actin shaft. Nat Commun. 2022;13:1636 pubmed publisher
Engevik A, Coutts A, Kaji I, Rodriguez P, Ongaratto F, Saqui Salces M, et al. Editing Myosin VB Gene to Create Porcine Model of Microvillus Inclusion Disease, With Microvillus-Lined Inclusions and Alterations in Sodium Transporters. Gastroenterology. 2020;158:2236-2249.e9 pubmed publisher
Royo M, Gutiérrez Y, Fernandez Monreal M, Gutiérrez Eisman S, Jimenez R, Jurado S, et al. A retention-release mechanism based on RAB11FIP2 for AMPA receptor synaptic delivery during long-term potentiation. J Cell Sci. 2019;132: pubmed publisher
Forteza R, Ahsan M, Cartón García F, Arango D, Ameen N, SALAS P. Glucocorticoids and myosin5b loss of function induce heightened PKA signaling in addition to membrane traffic defects. Mol Biol Cell. 2019;30:3076-3089 pubmed publisher
Xu W, Gulvady A, Goreczny G, Olson E, Turner C. Paxillin-dependent regulation of apical-basal polarity in mammary gland morphogenesis. Development. 2019;146: pubmed publisher
Yurkovetskiy L, Guney M, Kim K, Goh S, McCauley S, Dauphin A, et al. Primate immunodeficiency virus proteins Vpx and Vpr counteract transcriptional repression of proviruses by the HUSH complex. Nat Microbiol. 2018;3:1354-1361 pubmed publisher
Kravtsov D, Ahsan M, Kumari V, Van IJzendoorn S, Reyes Mugica M, Kumar A, et al. Identification of intestinal ion transport defects in microvillus inclusion disease. Am J Physiol Gastrointest Liver Physiol. 2016;311:G142-55 pubmed publisher
Cartón García F, Overeem A, Nieto R, Bazzocco S, Dopeso H, Macaya I, et al. Myo5b knockout mice as a model of microvillus inclusion disease. Sci Rep. 2015;5:12312 pubmed publisher
product information
brand :
Novus
catalog number base :
NBP1-87746
SKU :
NBP1-87746
product name :
Myosin VB Antibody - BSA Free
units size :
0.1 ml (also 25 ul)
description :
The Myosin VB Antibody - BSA Free from Novus is a rabbit polyclonal antibody to Myosin VB. This antibody reacts with human,mouse,rat. The Myosin VB Antibody - BSA Free has been validated for the following applications: IF/IHC,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Simple Western,Knockout Validated,Immunocytochemistry/ Immunofluorescence.
target :
Myosin VB
category :
Primary Antibodies
buffer :
PBS (pH 7.2) and 40% Glycerol
clonality :
Polyclonal
conjugate :
Unconjugated
all_available conjugate :
Unconjugated
host :
Rabbit
immunogen :
NLMKKELEEERSRYQNLVKEYSQLEQRYDNLRDEMTIIK
QTPGHRRNPSNQSSLESDSNYPSISTSEIGDTEDALQQV
EEIGLEKAAMDMTVFLK
This antibody was developed against Recombinant Protein corresponding to amino acids:
isotype :
IgG
purity :
Immunogen affinity purified
species :
Human,Mouse,Rat
gene symbol :
MYO5B
Antibody validation :
Independent Anitbodies
top caption :
Immunohistochemistry-Paraffin: Myosin VB Antibody [NBP1-87746]
applications :
IF/IHC,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Simple Western,Knockout Validated,Immunocytochemistry/ Immunofluorescence
USD :
559 USD
alt names :
KIAA1119, MYO5B variant protein, myosin VB, myosin-Vb
storage :
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
more info or order :
company information
Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com
3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.