Myosin VB Antibody - BSA Free | Novus Biologicals NBP1-87746 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

Myosin VB Antibody - BSA Free

catalog :

NBP1-87746

quantity :

0.1 ml (also 25 ul)

price :

559 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 15

Reference
Zaffagnini G, Cheng S, Salzer M, Pernaute B, Duran J, Irimia M, et al. Mouse oocytes sequester aggregated proteins in degradative super-organelles. Cell. 2024;187:1109-1126.e21 pubmed publisher
Gromova K, Thies E, Janiesch P, L xfc tzenkirchen F, Zhu Y, Stajano D, et al. The kinesin Kif21b binds myosin Va and mediates changes in actin dynamics underlying homeostatic synaptic downscaling. Cell Rep. 2023;42:112743 pubmed publisher
Zhao G, Liu S, Arun S, Renda F, Khodjakov A, Pellman D. A tubule-sheet continuum model for the mechanism of nuclear envelope assembly. Dev Cell. 2023;58:847-865.e10 pubmed publisher
Engevik K, Engevik M, Engevik A. Bioinformatics reveal elevated levels of Myosin Vb in uterine corpus endometrial carcinoma patients which correlates to increased cell metabolism and poor prognosis. PLoS ONE. 2023;18:e0280428 pubmed publisher
Ahsan M, Dos Reis D, Barbieri A, Sumigray K, Nottoli T, SALAS P, et al. Loss of Serum Glucocorticoid-Inducible Kinase 1 SGK1 Worsens Malabsorption and Diarrhea in Microvillus Inclusion Disease (MVID). J Clin Med. 2022;11: pubmed publisher
Sakai T, Choo Y, Sato O, Ikebe R, Jeffers A, Idell S, et al. Myo5b Transports Fibronectin-Containing Vesicles and Facilitates FN1 Secretion from Human Pleural Mesothelial Cells. Int J Mol Sci. 2022;23: pubmed publisher
Li Q, Zhou Z, Sun Y, Sun C, Klappe K, Van IJzendoorn S. A Functional Relationship Between UNC45A and MYO5B Connects Two Rare Diseases With Shared Enteropathy. Cell Mol Gastroenterol Hepatol. 2022;14:295-310 pubmed publisher
Leijnse N, Barooji Y, Arastoo M, Sønder S, Verhagen B, Wullkopf L, et al. Filopodia rotate and coil by actively generating twist in their actin shaft. Nat Commun. 2022;13:1636 pubmed publisher
Engevik A, Coutts A, Kaji I, Rodriguez P, Ongaratto F, Saqui Salces M, et al. Editing Myosin VB Gene to Create Porcine Model of Microvillus Inclusion Disease, With Microvillus-Lined Inclusions and Alterations in Sodium Transporters. Gastroenterology. 2020;158:2236-2249.e9 pubmed publisher
Royo M, Gutiérrez Y, Fernandez Monreal M, Gutiérrez Eisman S, Jimenez R, Jurado S, et al. A retention-release mechanism based on RAB11FIP2 for AMPA receptor synaptic delivery during long-term potentiation. J Cell Sci. 2019;132: pubmed publisher
Forteza R, Ahsan M, Cartón García F, Arango D, Ameen N, SALAS P. Glucocorticoids and myosin5b loss of function induce heightened PKA signaling in addition to membrane traffic defects. Mol Biol Cell. 2019;30:3076-3089 pubmed publisher
Xu W, Gulvady A, Goreczny G, Olson E, Turner C. Paxillin-dependent regulation of apical-basal polarity in mammary gland morphogenesis. Development. 2019;146: pubmed publisher
Yurkovetskiy L, Guney M, Kim K, Goh S, McCauley S, Dauphin A, et al. Primate immunodeficiency virus proteins Vpx and Vpr counteract transcriptional repression of proviruses by the HUSH complex. Nat Microbiol. 2018;3:1354-1361 pubmed publisher
Kravtsov D, Ahsan M, Kumari V, Van IJzendoorn S, Reyes Mugica M, Kumar A, et al. Identification of intestinal ion transport defects in microvillus inclusion disease. Am J Physiol Gastrointest Liver Physiol. 2016;311:G142-55 pubmed publisher
Cartón García F, Overeem A, Nieto R, Bazzocco S, Dopeso H, Macaya I, et al. Myo5b knockout mice as a model of microvillus inclusion disease. Sci Rep. 2015;5:12312 pubmed publisher

product information

master code :

NBP1-87746

SKU :

NBP1-87746

product name :

Myosin VB Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The Myosin VB Antibody - BSA Free from Novus is a rabbit polyclonal antibody to Myosin VB. This antibody reacts with human,mouse,rat. The Myosin VB Antibody - BSA Free has been validated for the following applications: IF/IHC,Western Blot,Immunohistochemistry-Paraffin,Knockout Validated,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry,Simple Western.

target :

Myosin VB

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

NLMKKELEEERSRYQNLVKEYSQLEQRYDNLRDEMTIIK
QTPGHRRNPSNQSSLESDSNYPSISTSEIGDTEDALQQV
EEIGLEKAAMDMTVFLK
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human,Mouse,Rat

gene symbol :

MYO5B

Antibody validation :

Independent Anitbodies

applications :

IF/IHC,Western Blot,Immunohistochemistry-Paraffin,Knockout Validated,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry,Simple Western

USD :

559 USD

alt names :

KIAA1119, MYO5B variant protein, myosin VB, myosin-Vb

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage