Myosin 1B Antibody - BSA Free | Novus Biologicals NBP1-87739 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

Myosin 1B Antibody - BSA Free

catalog :

NBP1-87739

quantity :

0.1 ml (also 25 ul)

price :

559 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, chicken

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 9

Published Application/Species/Sample/Dilution	Reference
immunocytochemistry; rat; 1:50; fig 1 western blot; rat; 1:500; fig 1	Kittelberger N, Breunig M, Martin R, KnÃ¶lker H, Miklavc P. The role of myosin 1c and myosin 1b in surfactant exocytosis. J Cell Sci. 2016;129:1685-96 pubmed publisher
	Zhao G, Liu S, Arun S, Renda F, Khodjakov A, Pellman D. A tubule-sheet continuum model for the mechanism of nuclear envelope assembly. Dev Cell. 2023;58:847-865.e10 pubmed publisher
	Santoriello C, Sporrij A, Yang S, Flynn R, Henriques T, Dorjsuren B, et al. RNA helicase DDX21 mediates nucleotide stress responses in neural crest and melanoma cells. Nat Cell Biol. 2020;22:372-379 pubmed publisher
	Argaud D, Boulanger M, Chignon A, Mkannez G, Mathieu P. Enhancer-mediated enrichment of interacting JMJD3-DDX21 to ENPP2 locus prevents R-loop formation and promotes transcription. Nucleic Acids Res. 2019;: pubmed publisher
	Bi X, Xu Y, Li T, Li X, Li W, Shao W, et al. RNA Targets Ribogenesis Factor WDR43 to Chromatin for Transcription and Pluripotency Control. Mol Cell. 2019;: pubmed publisher
	Calo E, Gu B, Bowen M, Aryan F, Zalc A, Liang J, et al. Tissue-selective effects of nucleolar stress and rDNA damage in developmental disorders. Nature. 2018;554:112-117 pubmed publisher
	Komaba S, Coluccio L. Myosin 1b Regulates Amino Acid Transport by Associating Transporters with the Apical Plasma Membrane of Kidney Cells. PLoS ONE. 2015;10:e0138012 pubmed publisher
	Rozbicki E, Chuai M, Karjalainen A, Song F, Sang H, Martin R, et al. Myosin-II-mediated cell shape changes and cell intercalation contribute to primitive streak formation. Nat Cell Biol. 2015;17:397-408 pubmed publisher
	Calo E, Flynn R, Martin L, Spitale R, Chang H, Wysocka J. RNA helicase DDX21 coordinates transcription and ribosomal RNA processing. Nature. 2015;518:249-53 pubmed publisher

product information

master code :

NBP1-87739

SKU :

NBP1-87739

product name :

Myosin 1B Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The Myosin 1B Antibody - BSA Free from Novus is a rabbit polyclonal antibody to Myosin 1B. This antibody reacts with avian - chicken,chicken,human,mouse,rat. The Myosin 1B Antibody - BSA Free has been validated for the following applications: IF/IHC,Western Blot,Immunohistochemistry,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence.

target :

Myosin 1B

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

LLNKLKLERDFSRYNYLSLDSAKVNGVDDAANFRTVRNA
MQIVGFMDHEAESVLAVVAAVLKLGNIEFKPESRVNGLD
ESKIKDKNELKEICELTGIDQSVLERAFSFRTVEAKQEK
VSTTLNVA
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Avian - Chicken,Chicken,Human,Mouse,Rat

gene symbol :

MYO1B

applications :

IF/IHC,Western Blot,Immunohistochemistry,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence

USD :

559 USD

alt names :

MMIa, MMI-alpha, MYH-1c, MYO1B variant protein, Myosin I alpha, myosin IB, myosin-I alpha, myosin-Ib, myr1

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage