Indoleamine 2,3-dioxygenase/IDO Antibody - BSA Free | Novus Biologicals NBP1-87702 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

Indoleamine 2,3-dioxygenase/IDO Antibody - BSA Free

catalog :

NBP1-87702

quantity :

0.1 ml (also 25 ul)

price :

559 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

clone name :

4.00E+07

reactivity :

human

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 22

Reference
Jacquerie A, Hoeben A, Eekers D, Postma A, Vanmechelen M, De Smet F, et al. Prognostic relevance of high expression of kynurenine pathway markers in glioblastoma. Sci Rep. 2024;14:14975 pubmed publisher
Tadokoro H, Hirayama A, Kudo R, Hasebe M, Yoshioka Y, Matsuzaki J, et al. Adenosine leakage from perforin-burst extracellular vesicles inhibits perforin secretion by cytotoxic T-lymphocytes. PLoS ONE. 2020;15:e0231430 pubmed publisher
Guastella A, Michelhaugh S, Klinger N, Fadel H, Kiousis S, Ali Fehmi R, et al. Investigation of the aryl hydrocarbon receptor and the intrinsic tumoral component of the kynurenine pathway of tryptophan metabolism in primary brain tumors. J Neurooncol. 2018;139:239-249 pubmed publisher
Guastella A, Michelhaugh S, Klinger N, Kupsky W, Polin L, Muzik O, et al. Tryptophan PET Imaging of the Kynurenine Pathway in Patient-Derived Xenograft Models of Glioblastoma. Mol Imaging. 2016;15: pubmed publisher
BosnyÃ¡k E, Kamson D, Guastella A, Varadarajan K, Robinette N, Kupsky W, et al. Molecular imaging correlates of tryptophan metabolism via the kynurenine pathway in human meningiomas. Neuro Oncol. 2015;17:1284-92 pubmed publisher
Jaiswal A, Armas M, Izumi T, Strauss P, Narayan S. Adenomatous polyposis coli interacts with flap endonuclease 1 to block its nuclear entry and function. Neoplasia. 2012;14:495-508 pubmed
Ma Y, Liang D, Liu J, Axcrona K, Kvalheim G, Stokke T, et al. Prostate cancer cell lines under hypoxia exhibit greater stem-like properties. PLoS ONE. 2011;6:e29170 pubmed publisher
Tann A, Boldogh I, Meiss G, Qian W, Van Houten B, Mitra S, et al. Apoptosis induced by persistent single-strand breaks in mitochondrial genome: critical role of EXOG (5'-EXO/endonuclease) in their repair. J Biol Chem. 2011;286:31975-83 pubmed publisher
Jaiswal A, Narayan S. Assembly of the base excision repair complex on abasic DNA and role of adenomatous polyposis coli on its functional activity. Biochemistry. 2011;50:1901-9 pubmed publisher
Guo Z, Zheng L, Xu H, Dai H, Zhou M, Pascua M, et al. Methylation of FEN1 suppresses nearby phosphorylation and facilitates PCNA binding. Nat Chem Biol. 2010;6:766-73 pubmed publisher
Asagoshi K, Liu Y, Masaoka A, Lan L, Prasad R, Horton J, et al. DNA polymerase beta-dependent long patch base excision repair in living cells. DNA Repair (Amst). 2010;9:109-19 pubmed publisher
Kong X, Mohanty S, Stephens J, Heale J, Gomez Godinez V, Shi L, et al. Comparative analysis of different laser systems to study cellular responses to DNA damage in mammalian cells. Nucleic Acids Res. 2009;37:e68 pubmed publisher
Guo Z, Zheng L, Dai H, Zhou M, Xu H, Shen B. Human DNA polymerase beta polymorphism, Arg137Gln, impairs its polymerase activity and interaction with PCNA and the cellular base excision repair capacity. Nucleic Acids Res. 2009;37:3431-41 pubmed publisher
Szczesny B, Tann A, Longley M, Copeland W, Mitra S. Long patch base excision repair in mammalian mitochondrial genomes. J Biol Chem. 2008;283:26349-56 pubmed publisher
Liu P, Qian L, Sung J, de Souza Pinto N, Zheng L, Bogenhagen D, et al. Removal of oxidative DNA damage via FEN1-dependent long-patch base excision repair in human cell mitochondria. Mol Cell Biol. 2008;28:4975-87 pubmed publisher
Guo Z, Qian L, Liu R, Dai H, Zhou M, Zheng L, et al. Nucleolar localization and dynamic roles of flap endonuclease 1 in ribosomal DNA replication and damage repair. Mol Cell Biol. 2008;28:4310-9 pubmed publisher
Guo Z, Chavez V, Singh P, Finger L, Hang H, Hegde M, et al. Comprehensive mapping of the C-terminus of flap endonuclease-1 reveals distinct interaction sites for five proteins that represent different DNA replication and repair pathways. J Mol Biol. 2008;377:679-90 pubmed publisher
Prasad R, Liu Y, Deterding L, Poltoratsky V, Kedar P, Horton J, et al. HMGB1 is a cofactor in mammalian base excision repair. Mol Cell. 2007;27:829-41 pubmed
Kundu C, Balusu R, Jaiswal A, Narayan S. Adenomatous polyposis coli-mediated hypersensitivity of mouse embryonic fibroblast cell lines to methylmethane sulfonate treatment: implication of base excision repair pathways. Carcinogenesis. 2007;28:2089-95 pubmed
Kedar P, Kim S, Robertson A, Hou E, Prasad R, Horton J, et al. Direct interaction between mammalian DNA polymerase beta and proliferating cell nuclear antigen. J Biol Chem. 2002;277:31115-23 pubmed
Shibata Y, Nakamura T. Defective flap endonuclease 1 activity in mammalian cells is associated with impaired DNA repair and prolonged S phase delay. J Biol Chem. 2002;277:746-54 pubmed
Qiu J, Li X, Frank G, Shen B. Cell cycle-dependent and DNA damage-inducible nuclear localization of FEN-1 nuclease is consistent with its dual functions in DNA replication and repair. J Biol Chem. 2001;276:4901-8 pubmed

product information

master code :

NBP1-87702

SKU :

NBP1-87702

product name :

Indoleamine 2,3-dioxygenase/IDO Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The Indoleamine 2,3-dioxygenase/IDO Antibody - BSA Free from Novus is a rabbit polyclonal antibody to Indoleamine 2,3-dioxygenase/IDO. This antibody reacts with human. The Indoleamine 2,3-dioxygenase/IDO Antibody - BSA Free has been validated for the following applications: IF/IHC,Western Blot,Immunohistochemistry-Paraffin,Immunohistochemistry,Simple Western.

target :

Indoleamine 2,3-dioxygenase/IDO

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

LCSLESNPSVREFVLSKGDAGLREAYDACVKALVSLRSY
HLQIVTKYILIPASQQPKENKTSEDPSKLEAKGTGGTDL
MNFLK
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human

theoretical molecular weight :

45 kDa

gene symbol :

IDO1

Antibody validation :

Orthogonal Validation

accessionNumbers :

P14902

applications :

IF/IHC,Western Blot,Immunohistochemistry-Paraffin,Immunohistochemistry,Simple Western

USD :

559 USD

alt names :

EC 1.13.11.52, IDOIDO-1, INDOindole 2,3-dioxygenase, indoleamine 2,3-dioxygenase 1, indoleamine-pyrrole 2,3 dioxygenase, Indoleamine-pyrrole 2,3-dioxygenase

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage