FABP1/L-FABP Antibody - BSA Free | Novus Biologicals NBP1-87695 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

FABP1/L-FABP Antibody - BSA Free

catalog :

NBP1-87695

quantity :

0.1 ml (also 25 ul)

price :

579 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

clone name :

PCK-26

reactivity :

human, mouse, rat

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section, immunohistochemistry - frozen section

more info or order :

Novus Biologicals product webpage

citations: 12

Reference
Co J, Klein J, Kang S, Homan K. Suspended hydrogel culture as a method to scale up intestinal organoids. Sci Rep. 2023;13:10412 pubmed publisher
Lanik W, Luke C, Nolan L, Gong Q, Frazer L, Rimer J, et al. Microfluidic device facilitates in vitro modeling of human neonatal necrotizing enterocolitis-on-a-chip. JCI Insight. 2023;8: pubmed publisher
Huang X, Li T, Li T, Xing S, Tian J, Ding Y, et al. Embryogenic stem cell-derived intestinal crypt fission directs de novo crypt genesis. Cell Rep. 2022;41:111796 pubmed publisher
Ohara T, Colonna M, Stappenbeck T. Adaptive differentiation promotes intestinal villus recovery. Dev Cell. 2022;57:166-179.e6 pubmed publisher
Chen Y, Liu K, Jang C, Hsu C, Yen Y, Liu Y, et al. ERK Activation Modulates Cancer Stemness and Motility of a Novel Mouse Oral Squamous Cell Carcinoma Cell Line. Cancers (Basel). 2019;12: pubmed publisher
Westrich J, Vermeer D, Silva A, Bonney S, Berger J, Cicchini L, et al. CXCL14 suppresses human papillomavirus-associated head and neck cancer through antigen-specific CD8+ T-cell responses by upregulating MHC-I expression. Oncogene. 2019;: pubmed publisher
Chung H, Weng J, King C, Chuang C, Chow W, Chang Y. BDNF elevates the axonal levels of hnRNPs Q and R in cultured rat cortical neurons. Mol Cell Neurosci. 2019;98:97-108 pubmed publisher
Tarasco E, Pellegrini G, Whiting L, Lutz T. Phenotypical heterogeneity in responder and nonresponder male ApoE*3Leiden.CETP mice. Am J Physiol Gastrointest Liver Physiol. 2018;315:G602-G617 pubmed publisher
Dervas E, Hepojoki J, Laimbacher A, Romero Palomo F, Jelinek C, Keller S, et al. Nidovirus-Associated Proliferative Pneumonia in the Green Tree Python (Morelia viridis). J Virol. 2017;91: pubmed publisher
Yan K, Gevaert O, Zheng G, Anchang B, Probert C, Larkin K, et al. Intestinal Enteroendocrine Lineage Cells Possess Homeostatic and Injury-Inducible Stem Cell Activity. Cell Stem Cell. 2017;21:78-90.e6 pubmed publisher
Yan K, Janda C, Chang J, Zheng G, Larkin K, Luca V, et al. Non-equivalence of Wnt and R-spondin ligands during Lgr5+ intestinal stem-cell self-renewal. Nature. 2017;545:238-242 pubmed publisher
Meeker R, Bragg D, Poulton W, HUDSON L. Transmigration of macrophages across the choroid plexus epithelium in response to the feline immunodeficiency virus. Cell Tissue Res. 2012;347:443-55 pubmed publisher

product information

master code :

NBP1-87695

SKU :

NBP1-87695

product name :

FABP1/L-FABP Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The FABP1/L-FABP Antibody - BSA Free from Novus is a rabbit polyclonal antibody to FABP1/L-FABP. This antibody reacts with human,mouse,rat. The FABP1/L-FABP Antibody - BSA Free has been validated for the following applications: Immunohistochemistry,Immunohistochemistry-Paraffin,Immunohistochemistry-Frozen,Western Blot,Immunocytochemistry/ Immunofluorescence.

target :

FABP1/L-FABP

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVS
EIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEK
VKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGD
IVFKRISKRI
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human,Mouse,Rat

gene symbol :

FABP1

Antibody validation :

Orthogonal Validation

applications :

Immunohistochemistry,Immunohistochemistry-Paraffin,Immunohistochemistry-Frozen,Western Blot,Immunocytochemistry/ Immunofluorescence

USD :

579 USD

alt names :

FABPL, fatty acid binding protein 1, liver, fatty acid-binding protein, liver, L-FABPFatty acid-binding protein 1, Liver-type fatty acid-binding protein

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage