product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
Aquaporin-4 Antibody - BSA Free
catalog :
NBP1-87679
quantity :
0.1 ml (also 25 ul)
price :
559 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat, bovine
application :
western blot, immunohistochemistry, immunocytochemistry, immunoprecipitation, immunohistochemistry - paraffin section, immunohistochemistry - frozen section
more info or order :
citations: 29
Published Application/Species/Sample/DilutionReference
  • immunohistochemistry; rat; 1:500; loading ...; fig 7a, 7b, 7c, 7d
Koundal S, Elkin R, Nadeem S, Xue Y, Constantinou S, Sanggaard S, et al. Optimal Mass Transport with Lagrangian Workflow Reveals Advective and Diffusion Driven Solute Transport in the Glymphatic System. Sci Rep. 2020;10:1990 pubmed publisher
Yang Q, Yasvoina M, Olvera Barrios A, Mendes J, Zhu M, Egan C, et al. Deciphering the Connection Between Microvascular Damage and Neurodegeneration in Early Diabetic Retinopathy. Diabetes. 2024;73:1883-1894 pubmed publisher
Munro D, Bestard Cuche N, McQuaid C, Chagnot A, Shabestari S, Chadarevian J, et al. Microglia protect against age-associated brain pathologies. Neuron. 2024;112:2732-2748.e8 pubmed publisher
Beretta C, Svensson E, Dakhel A, Zy x15b k M, Hanrieder J, Sehlin D, et al. Amyloid-β deposits in human astrocytes contain truncated and highly resistant proteoforms. Mol Cell Neurosci. 2024;128:103916 pubmed publisher
Micha x142 ek K, Oberska P, Murawski M, Schwarz T, Tomaszewska E, Muszy x144 ski S, et al. Kidney morphology and renal expression of aquaporins 2, 3 and 4 during cerulein - Induced chronic pancreatitis in pigs. Adv Med Sci. 2023;68:306-313 pubmed publisher
Konstantinidis E, Dakhel A, Beretta C, Erlandsson A. Long-term effects of amyloid-beta deposits in human iPSC-derived astrocytes. Mol Cell Neurosci. 2023;125:103839 pubmed publisher
Zy x15b k M, Beretta C, Naia L, Dakhel A, P xe5 v xe9 nius L, Brismar H, et al. Amyloid-β accumulation in human astrocytes induces mitochondrial disruption and changed energy metabolism. J Neuroinflammation. 2023;20:43 pubmed publisher
Xu C, Wang F, Su C, Guo X, Li J, Lin J. Restoration of aquaporin-4 polarization in the spinal glymphatic system by metformin in rats with painful diabetic neuropathy. Neuroreport. 2023;34:190-197 pubmed publisher
Palavicini J, Ding L, Pan M, Qiu S, Wang H, Shen Q, et al. Sulfatide Deficiency, an Early Alzheimer's Lipidomic Signature, Causes Brain Ventricular Enlargement in the Absence of Classical Neuropathological Hallmarks. Int J Mol Sci. 2022;24: pubmed publisher
Wang F, Xu C, Su C, Li J, Lin J. β-Hydroxybutyrate Attenuates Painful Diabetic Neuropathy via Restoration of the Aquaporin-4 Polarity in the Spinal Glymphatic System. Front Neurosci. 2022;16:926128 pubmed publisher
Wang G, Wang F, He Y, Lin J. Plasticity of the spinal glymphatic system in male SD rats with painful diabetic neuropathy induced by type 2 diabetes mellitus. J Neurosci Res. 2022;100:1908-1920 pubmed publisher
Xue Y, Gursky Z, Monte B, Koundal S, Liu X, Lee H, et al. Sustained glymphatic transport and impaired drainage to the nasal cavity observed in multiciliated cell ciliopathies with hydrocephalus. Fluids Barriers CNS. 2022;19:20 pubmed publisher
Lyu Z, Park J, Kim K, Jin H, Wu H, Rajadas J, et al. A neurovascular-unit-on-a-chip for the evaluation of the restorative potential of stem cell therapies for ischaemic stroke. Nat Biomed Eng. 2021;5:847-863 pubmed publisher
Grabowska M, Michałek K, Kędzierska Kapuza K, Kram A, Gill K, Piasecka M. The long-term effects of rapamycin-based immunosuppressive protocols on the expression of renal aquaporins 1, 2, 3 and 4 water channels in rats. Histol Histopathol. 2021;36:459-474 pubmed publisher
Chung S, Kim J, Yoon J, Suh D, Yeo W, Lee Y. Atrogin1-induced loss of aquaporin 4 in myocytes leads to skeletal muscle atrophy. Sci Rep. 2020;10:14189 pubmed publisher
Zwaans B, Wegner K, Bartolone S, Vezina C, Chancellor M, Lamb L. Radiation cystitis modeling: A comparative study of bladder fibrosis radio-sensitivity in C57BL/6, C3H, and BALB/c mice. Physiol Rep. 2020;8:e14377 pubmed publisher
Willemse J, Verstegen M, Vermeulen A, Schurink I, Roest H, van der Laan L, et al. Fast, robust and effective decellularization of whole human livers using mild detergents and pressure controlled perfusion. Mater Sci Eng C Mater Biol Appl. 2020;108:110200 pubmed publisher
Seo Y, Ko I, Park H, Jeong Y, Park J, Kim K, et al. Radiation-Induced Changes in Tumor Vessels and Microenvironment Contribute to Therapeutic Resistance in Glioblastoma. Front Oncol. 2019;9:1259 pubmed publisher
Denver P, D Adamo H, Hu S, Zuo X, Zhu C, Okuma C, et al. A Novel Model of Mixed Vascular Dementia Incorporating Hypertension in a Rat Model of Alzheimer's Disease. Front Physiol. 2019;10:1269 pubmed publisher
Guo X, Fereydooni A, Isaji T, Gorecka J, Liu S, Hu H, et al. Inhibition of the Akt1-mTORC1 Axis Alters Venous Remodeling to Improve Arteriovenous Fistula Patency. Sci Rep. 2019;9:11046 pubmed publisher
Yang J, Wang B, Li N, Zhou Q, Zhou W, Zhan Z. Salvia miltiorrhiza and Carthamus tinctorius Extract Prevents Cardiac Fibrosis and Dysfunction after Myocardial Infarction by Epigenetically Inhibiting Smad3 Expression. Evid Based Complement Alternat Med. 2019;2019:6479136 pubmed publisher
Michałek K, Grabowska M. Investigating cellular location of aquaporins in the bovine kidney. A new view on renal physiology in cattle. Res Vet Sci. 2019;125:162-169 pubmed publisher
Wang X, Pan J, Liu H, Zhang M, Liu D, Lu L, et al. AIM2 gene silencing attenuates diabetic cardiomyopathy in type 2 diabetic rat model. Life Sci. 2019;221:249-258 pubmed publisher
Zhang M, Zhu P, Wang Y, Wu J, Yu Y, Wu X, et al. Bilateral sympathetic stellate ganglionectomy attenuates myocardial remodelling and fibrosis in a rat model of chronic volume overload. J Cell Mol Med. 2019;23:1001-1013 pubmed publisher
Angel P, Comte Walters S, Ball L, Talbot K, Mehta A, Brockbank K, et al. Mapping Extracellular Matrix Proteins in Formalin-Fixed, Paraffin-embedded Tissues by MALDI Imaging Mass Spectrometry. J Proteome Res. 2017;: pubmed publisher
Schreckenberg R, Horn A, da Costa Rebelo R, Simsekyilmaz S, Niemann B, Li L, et al. Effects of 6-months' Exercise on Cardiac Function, Structure and Metabolism in Female Hypertensive Rats-The Decisive Role of Lysyl Oxidase and Collagen III. Front Physiol. 2017;8:556 pubmed publisher
Teo Z, Chan J, Chong H, Sng M, Choo C, Phua G, et al. Angiopoietin-like 4 induces a β-catenin-mediated upregulation of ID3 in fibroblasts to reduce scar collagen expression. Sci Rep. 2017;7:6303 pubmed publisher
López Rodríguez A, Acaz Fonseca E, Viveros M, Garcia Segura L. Changes in cannabinoid receptors, aquaporin 4 and vimentin expression after traumatic brain injury in adolescent male mice. Association with edema and neurological deficit. PLoS ONE. 2015;10:e0128782 pubmed publisher
Lee H, Kim Y, Ok J, Lee Y, Ha M. Effect of a single subacromial prednisolone injection in acute rotator cuff tears in a rat model. Knee Surg Sports Traumatol Arthrosc. 2015;23:555-61 pubmed publisher
product information
brand :
Novus
catalog number base :
NBP1-87679
SKU :
NBP1-87679
product name :
Aquaporin-4 Antibody - BSA Free
units size :
0.1 ml (also 25 ul)
description :
The Aquaporin-4 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to Aquaporin-4. This antibody reacts with bovine,human,mouse,porcine,rat. The Aquaporin-4 Antibody - BSA Free has been validated for the following applications: IF/IHC,Immunohistochemistry,Immunoprecipitation,Western Blot,Immunohistochemistry-Paraffin,Immunohistochemistry-Frozen,Immunocytochemistry/ Immunofluorescence.
target :
Aquaporin-4
category :
Primary Antibodies
buffer :
PBS (pH 7.2), 40% Glycerol
clonality :
Polyclonal
conjugate :
Unconjugated
all_available conjugate :
Unconjugated
host :
Rabbit
immunogen :
CPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDD
LILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV
This antibody was developed against Recombinant Protein corresponding to amino acids:
isotype :
IgG
purity :
Immunogen affinity purified
species :
Bovine,Human,Mouse,Porcine,Rat
theoretical molecular weight :
35 kDa
gene symbol :
AQP4
review stars :
5
Antibody validation :
Orthogonal Validation
top caption :
Immunohistochemistry-Paraffin: Aquaporin-4 Antibody [NBP1-87679]
accessionNumbers :
P55087
applications :
IF/IHC,Immunohistochemistry,Immunoprecipitation,Western Blot,Immunohistochemistry-Paraffin,Immunohistochemistry-Frozen,Immunocytochemistry/ Immunofluorescence
USD :
559 USD
alt names :
aquaporin 4, MGC22454
storage :
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
more info or order :
company information
Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com
3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.