Aconitase 1 Antibody - BSA Free | Novus Biologicals NBP1-87677 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

Aconitase 1 Antibody - BSA Free

catalog :

NBP1-87677

quantity :

0.1 ml (also 25 ul)

price :

559 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 6

Reference
Gu W, Fillebeen C, Pantopoulos K. Human IRP1 Translocates to the Nucleus in a Cell-Specific and Iron-Dependent Manner. Int J Mol Sci. 2022;23: pubmed publisher
Sun X, Lv Y, Wang J, Cheng H, Huang J, Du Y, et al. Differential protein expression profiling by iTRAQ-2D-LC-MS/MS of rats treated with oxaliplatin. J Cell Biochem. 2019;120:18128-18141 pubmed publisher
Gangwar A, Paul S, Ahmad Y, Bhargava K. Competing trends of ROS and RNS-mediated protein modifications during hypoxia as an alternate mechanism of NO benefits. Biochimie. 2018;148:127-138 pubmed publisher
Paul S, Gangwar A, Bhargava K, Ahmad Y. STAT3-RXR-Nrf2 activates systemic redox and energy homeostasis upon steep decline in pO2 gradient. Redox Biol. 2018;14:423-438 pubmed publisher
Zhao M, Liu Q, Gong Y, Xu X, Zhang C, Liu X, et al. GSH-dependent antioxidant defense contributes to the acclimation of colon cancer cells to acidic microenvironment. Cell Cycle. 2016;15:1125-33 pubmed publisher
Dongiovanni P, Lanti C, Gatti S, Rametta R, Recalcati S, Maggioni M, et al. High fat diet subverts hepatocellular iron uptake determining dysmetabolic iron overload. PLoS ONE. 2015;10:e0116855 pubmed publisher

product information

master code :

NBP1-87677

SKU :

NBP1-87677

product name :

Aconitase 1 Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The Aconitase 1 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to Aconitase 1. This antibody reacts with human,mouse,rat. The Aconitase 1 Antibody - BSA Free has been validated for the following applications: Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence.

target :

Aconitase 1

category :

Primary Antibodies

buffer :

PBS (pH 7.2), 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

YERIHRSNLVGMGVIPLEYLPGENADALGLTGQERYTII
IPENLKPQMKVQVKLDTGKTFQAVMRFDTDVELTYFLNG
GILNYMIRKMAK
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human,Mouse,Rat

gene symbol :

ACO1

Antibody validation :

Orthogonal Validation

applications :

Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence

USD :

559 USD

alt names :

Aconitase, aconitase 1, soluble, aconitate hydratase, Citrate hydro-lyase, cytoplasmic aconitate hydratase, EC 4.2.1, EC 4.2.1.3, Ferritin repressor protein, IREB1IREBP1, IREBP, IRE-BP 1, Iron regulatory protein 1, iron-responsive element binding protein 1, Iron-responsive element-binding protein 1, IRP1ACONS

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage