product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
Filaggrin Antibody - BSA Free
catalog :
NBP1-87528
quantity :
0.1 ml (also 25 ul)
price :
559 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section
more info or order :
citations: 9
Reference
Correa Araujo L, Prieto Abello L, Lara Bertrand A, Medina Solano M, Guerrero L, Camacho B, et al. Bioengineered skin constructs based on mesenchymal stromal cells and acellular dermal matrix exposed to inflammatory microenvironment releasing growth factors involved in skin repair. Stem Cell Res Ther. 2023;14:306 pubmed publisher
Uhm C, Jeong H, Lee S, Hwang J, Lim K, Nam K. Comparison of structural characteristics and molecular markers of rabbit skin, pig skin, and reconstructed human epidermis for an ex vivo human skin model. Toxicol Res. 2023;39:477-484 pubmed publisher
Liu J, Chen J, Zhong Y, Yu X, Lu P, Feng J, et al. OSMRβ mutants enhance basal keratinocyte differentiation via inactivation of the STAT5/KLF7 axis in PLCA patients. Protein Cell. 2021;: pubmed publisher
Gan L, Sun J, Yang S, Zhang X, Chen W, Sun Y, et al. Chromatin-Binding Protein PHF6 Regulates Activity-Dependent Transcriptional Networks to Promote Hunger Response. Cell Rep. 2020;30:3717-3728.e6 pubmed publisher
Warmerdam D, Alonso de Vega I, Wiegant W, van den Broek B, Rother M, Wolthuis R, et al. PHF6 promotes non-homologous end joining and G2 checkpoint recovery. EMBO Rep. 2019;:e48460 pubmed publisher
Xiang J, Wang G, Xia T, Chen Z. The depletion of PHF6 decreases the drug sensitivity of T-cell acute lymphoblastic leukemia to prednisolone. Biomed Pharmacother. 2019;109:2210-2217 pubmed publisher
Cheng C, Deng P, Ikeuchi Y, Yuede C, Li D, Rensing N, et al. Characterization of a Mouse Model of Börjeson-Forssman-Lehmann Syndrome. Cell Rep. 2018;25:1404-1414.e6 pubmed publisher
Jang H, Myung H, Lee J, Myung J, Jang W, Lee S, et al. Impaired Skin Barrier Due to Sebaceous Gland Atrophy in the Latent Stage of Radiation-Induced Skin Injury: Application of Non-Invasive Diagnostic Methods. Int J Mol Sci. 2018;19: pubmed publisher
Meacham C, LAWTON L, Soto Feliciano Y, Pritchard J, Joughin B, Ehrenberger T, et al. A genome-scale in vivo loss-of-function screen identifies Phf6 as a lineage-specific regulator of leukemia cell growth. Genes Dev. 2015;29:483-8 pubmed publisher
product information
brand :
Novus
catalog number base :
NBP1-87528
SKU :
NBP1-87528
product name :
Filaggrin Antibody - BSA Free
units size :
0.1 ml (also 25 ul)
description :
The Filaggrin Antibody - BSA Free from Novus is a rabbit polyclonal antibody to Filaggrin. This antibody reacts with human,mouse. The Filaggrin Antibody - BSA Free has been validated for the following applications: Immunohistochemistry,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence.
target :
Filaggrin
category :
Primary Antibodies
buffer :
PBS (pH 7.2) and 40% Glycerol
clonality :
Polyclonal
conjugate :
Unconjugated
all_available conjugate :
Unconjugated
host :
Rabbit
immunogen :
RKRLSERLEEKEDNEEGVYDYENTGRMTQKWIQSGHIAT
YYTIQDEAYDTTDSLLEENKIYERSRSSDGKSSSQVNRS
RHENTSQVPLQESR
This antibody was developed against Recombinant Protein corresponding to amino acids:
isotype :
IgG
purity :
Immunogen affinity purified
species :
Human,Mouse
gene symbol :
FLG
review stars :
4
Antibody validation :
Independent Anitbodies
top caption :
Immunohistochemistry-Paraffin: Filaggrin Antibody [NBP1-87528]
applications :
Immunohistochemistry,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence
USD :
559 USD
alt names :
ATOD2, epidermal filaggrin, filaggrin, Profilaggrin
storage :
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
more info or order :
company information
Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com
3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.