Filaggrin Antibody - BSA Free | Novus Biologicals NBP1-87528 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

Filaggrin Antibody - BSA Free

catalog :

NBP1-87528

quantity :

0.1 ml (also 25 ul)

price :

559 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human

application :

immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 9

Reference
Correa Araujo L, Prieto Abello L, Lara Bertrand A, Medina Solano M, Guerrero L, Camacho B, et al. Bioengineered skin constructs based on mesenchymal stromal cells and acellular dermal matrix exposed to inflammatory microenvironment releasing growth factors involved in skin repair. Stem Cell Res Ther. 2023;14:306 pubmed publisher
Uhm C, Jeong H, Lee S, Hwang J, Lim K, Nam K. Comparison of structural characteristics and molecular markers of rabbit skin, pig skin, and reconstructed human epidermis for an ex vivo human skin model. Toxicol Res. 2023;39:477-484 pubmed publisher
Liu J, Chen J, Zhong Y, Yu X, Lu P, Feng J, et al. OSMRβ mutants enhance basal keratinocyte differentiation via inactivation of the STAT5/KLF7 axis in PLCA patients. Protein Cell. 2021;: pubmed publisher
Gan L, Sun J, Yang S, Zhang X, Chen W, Sun Y, et al. Chromatin-Binding Protein PHF6 Regulates Activity-Dependent Transcriptional Networks to Promote Hunger Response. Cell Rep. 2020;30:3717-3728.e6 pubmed publisher
Warmerdam D, Alonso de Vega I, Wiegant W, van den Broek B, Rother M, Wolthuis R, et al. PHF6 promotes non-homologous end joining and G2 checkpoint recovery. EMBO Rep. 2019;:e48460 pubmed publisher
Xiang J, Wang G, Xia T, Chen Z. The depletion of PHF6 decreases the drug sensitivity of T-cell acute lymphoblastic leukemia to prednisolone. Biomed Pharmacother. 2019;109:2210-2217 pubmed publisher
Cheng C, Deng P, Ikeuchi Y, Yuede C, Li D, Rensing N, et al. Characterization of a Mouse Model of Börjeson-Forssman-Lehmann Syndrome. Cell Rep. 2018;25:1404-1414.e6 pubmed publisher
Jang H, Myung H, Lee J, Myung J, Jang W, Lee S, et al. Impaired Skin Barrier Due to Sebaceous Gland Atrophy in the Latent Stage of Radiation-Induced Skin Injury: Application of Non-Invasive Diagnostic Methods. Int J Mol Sci. 2018;19: pubmed publisher
Meacham C, LAWTON L, Soto Feliciano Y, Pritchard J, Joughin B, Ehrenberger T, et al. A genome-scale in vivo loss-of-function screen identifies Phf6 as a lineage-specific regulator of leukemia cell growth. Genes Dev. 2015;29:483-8 pubmed publisher

product information

master code :

NBP1-87528

SKU :

NBP1-87528

product name :

Filaggrin Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The Filaggrin Antibody - BSA Free from Novus is a rabbit polyclonal antibody to Filaggrin. This antibody reacts with human,mouse. The Filaggrin Antibody - BSA Free has been validated for the following applications: Immunohistochemistry,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence.

target :

Filaggrin

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

RKRLSERLEEKEDNEEGVYDYENTGRMTQKWIQSGHIAT
YYTIQDEAYDTTDSLLEENKIYERSRSSDGKSSSQVNRS
RHENTSQVPLQESR
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human,Mouse

gene symbol :

FLG

Antibody validation :

Independent Anitbodies

applications :

Immunohistochemistry,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence

USD :

559 USD

alt names :

ATOD2, epidermal filaggrin, filaggrin, Profilaggrin

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage