Transketolase Antibody - BSA Free | Novus Biologicals NBP1-87441 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

Transketolase Antibody - BSA Free

catalog :

NBP1-87441

quantity :

0.1 ml (also 25 ul)

price :

559 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 6

Reference
Chen Y, Zhang T, Zeng S, Xu R, Jin K, Coorey N, et al. Transketolase in human Müller cells is critical to resist light stress through the pentose phosphate and NRF2 pathways. Redox Biol. 2022;54:102379 pubmed publisher
Scaffa A, Yao H, Oulhen N, Wallace J, Peterson A, Rizal S, et al. Single-cell transcriptomics reveals lasting changes in the lung cellular landscape into adulthood after neonatal hyperoxic exposure. Redox Biol. 2021;:102091 pubmed publisher
Miyagawa K, Ohata Y, Delgado Calle J, Teramachi J, Zhou H, Dempster D, et al. Osteoclast-derived IGF1 is required for pagetic lesion formation in vivo. JCI Insight. 2020;5: pubmed publisher
Li Z, Yan M, Yu Y, Wang Y, Lei G, Pan Y, et al. LncRNA H19 promotes the committed differentiation of stem cells from apical papilla via miR-141/SPAG9 pathway. Cell Death Dis. 2019;10:130 pubmed publisher
Wang Y, Lu Y, Li Z, Zhou Y, Gu Y, Pang X, et al. Oestrogen receptor α regulates the odonto/osteogenic differentiation of stem cells from apical papilla via ERK and JNK MAPK pathways. Cell Prolif. 2018;51:e12485 pubmed publisher
Wang Y, Zhou Y, Jin L, Pang X, Lu Y, Wang Z, et al. Mineral trioxide aggregate enhances the osteogenic capacity of periodontal ligament stem cells via NF-?B and MAPK signaling pathways. J Cell Physiol. 2018;233:2386-2397 pubmed publisher

product information

master code :

NBP1-87441

SKU :

NBP1-87441

product name :

Transketolase Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The Transketolase Antibody - BSA Free from Novus is a rabbit polyclonal antibody to Transketolase. This antibody reacts with human,mouse,rat. The Transketolase Antibody - BSA Free has been validated for the following applications: IF/IHC,Western Blot,Immunohistochemistry,Immunohistochemistry-Paraffin,Knockdown Validated,Immunocytochemistry/ Immunofluorescence.

target :

Transketolase

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

IAKTFKGRGITGVEDKESWHGKPLPKNMAEQIIQEIYSQ
IQSKKKILATPPQEDAPSVDIANIRMPSLPSYKVGDKIA
TRKAYGQ
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human,Mouse,Rat

gene symbol :

TKT

Antibody validation :

Independent Anitbodies

applications :

IF/IHC,Western Blot,Immunohistochemistry,Immunohistochemistry-Paraffin,Knockdown Validated,Immunocytochemistry/ Immunofluorescence

USD :

559 USD

alt names :

EC 2.2.1.1, FLJ34765, TK, TKT1, transketolase

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage