Ornithine Carbamoyltransferase Antibody - BSA Free | Novus Biologicals NBP1-87408 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

Ornithine Carbamoyltransferase Antibody - BSA Free

catalog :

NBP1-87408

quantity :

0.1 ml (also 25 ul)

price :

549 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 7

Reference
Chin R, Rakhit R, Ditsworth D, Wang C, Bartholoméüs J, Liu S, et al. Pharmacological PINK1 activation ameliorates Pathology in Parkinson's Disease models. bioRxiv. 2023;: pubmed publisher
GIESSEL A, Dousis A, Ravichandran K, Smith K, Sur S, McFadyen I, et al. Therapeutic enzyme engineering using a generative neural network. Sci Rep. 2022;12:1536 pubmed publisher
Balestra D, Ferrarese M, Lombardi S, Ziliotto N, Branchini A, Petersen N, et al. An Exon-Specific Small Nuclear U1 RNA (ExSpeU1) Improves Hepatic OTC Expression in a Splicing-Defective spf/ash Mouse Model of Ornithine Transcarbamylase Deficiency. Int J Mol Sci. 2020;21: pubmed publisher
Jang I, Kim E, Lim J, Kim M, Ban T, Yoon H, et al. Effects of Resveratrol on the Renin-Angiotensin System in the Aging Kidney. Nutrients. 2018;10: pubmed publisher
Zhang X, Cai J, Yang Y, Zeng Y, Zeng H, Wang M, et al. Telmisartan attenuates kidney apoptosis and autophagy-related protein expression levels in an intermittent hypoxia mouse model. Sleep Breath. 2019;23:341-348 pubmed publisher
Abuohashish H, Ahmed M, Sabry D, Khattab M, Al Rejaie S. ACE-2/Ang1-7/Mas cascade mediates ACE inhibitor, captopril, protective effects in estrogen-deficient osteoporotic rats. Biomed Pharmacother. 2017;92:58-68 pubmed publisher
Baker D, Childs B, Durik M, Wijers M, Sieben C, Zhong J, et al. Naturally occurring p16(Ink4a)-positive cells shorten healthy lifespan. Nature. 2016;530:184-9 pubmed publisher

product information

master code :

NBP1-87408

SKU :

NBP1-87408

product name :

Ornithine Carbamoyltransferase Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The Ornithine Carbamoyltransferase Antibody - BSA Free from Novus is a rabbit polyclonal antibody to Ornithine Carbamoyltransferase. This antibody reacts with human,mouse. The Ornithine Carbamoyltransferase Antibody - BSA Free has been validated for the following applications: IF/IHC,Western Blot,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry,Immunohistochemistry-Paraffin,Simple Western.

target :

Ornithine Carbamoyltransferase

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

ILADYLTLQEHYSSLKGLTLSWIGDGNNILHSIMMSAAK
FGMHLQAATPKGYEPDASVTKLAEQYAKENGTKLLLTND
PLEAAHGGNVLITDTWISMGQEEEKKKRLQAFQGYQVTM
KTAKVAASDWT
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human,Mouse

gene symbol :

OTC

Antibody validation :

Independent Anitbodies

applications :

IF/IHC,Western Blot,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry,Immunohistochemistry-Paraffin,Simple Western

USD :

549 USD

alt names :

EC 2.1.3, EC 2.1.3.3, MGC129967, MGC129968, MGC138856, OCTD, ornithine carbamoyltransferase, ornithine carbamoyltransferase, mitochondrial, Ornithine transcarbamylase, OTCase

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage