product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
Occludin Antibody - BSA Free
catalog :
NBP1-87402
quantity :
0.1 ml (also 25 ul)
price :
599 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
clone name :
6F12-H4
reactivity :
human, mouse, rat
application :
western blot, ELISA, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section
more info or order :
citations: 38
Published Application/Species/Sample/DilutionReference
  • immunohistochemistry; mouse; 1:600; loading ...; fig 5b
Shinde T, Perera A, Vemuri R, Gondalia S, Beale D, Karpe A, et al. Synbiotic supplementation with prebiotic green banana resistant starch and probiotic Bacillus coagulans spores ameliorates gut inflammation in mouse model of inflammatory bowel diseases. Eur J Nutr. 2020;: pubmed publisher
  • immunohistochemistry - paraffin section; mouse; 1:600; loading ...; fig 3a
Shastri S, Shinde T, Sohal S, Gueven N, Eri R. Idebenone Protects against Acute Murine Colitis via Antioxidant and Anti-Inflammatory Mechanisms. Int J Mol Sci. 2020;21: pubmed publisher
Pretorius L, Smith C. Green rooibos (Aspalathus linearis) promotes gut health: insight into mechanisms. J Ethnopharmacol. 2024;319:117379 pubmed publisher
Werawatganon D, Vivatvakin S, Somanawat K, Tumwasorn S, Klaikeaw N, Siriviriyakul P, et al. Effects of probiotics on pancreatic inflammation and intestinal integrity in mice with acute pancreatitis. BMC Complement Med Ther. 2023;23:166 pubmed publisher
Wang S, Zhou J, Lu J, Lin Y, Liu S, Chen K. A ketogenic diet improves vascular hyperpermeability in type 2 diabetic mice by downregulating vascular pescadillo1 expression. J Cell Mol Med. 2023;27:1410-1422 pubmed publisher
Hamade D, Epperly M, Fisher R, Hou W, Shields D, van Pijkeren J, et al. Release of Interferon-β (IFN-β) from Probiotic Limosilactobacillus reuteri-IFN-β (LR-IFN-β) Mitigates Gastrointestinal Acute Radiation Syndrome (GI-ARS) following Whole Abdominal Irradiation. Cancers (Basel). 2023;15: pubmed publisher
Pretorius L, Smith C. Aspalathus linearis (Rooibos) and Agmatine May Act Synergistically to Beneficially Modulate Intestinal Tight Junction Integrity and Inflammatory Profile. Pharmaceuticals (Basel). 2022;15: pubmed publisher
Kansakar U, Gambardella J, Varzideh F, Avvisato R, Jankauskas S, Mone P, et al. miR-142 Targets TIM-1 in Human Endothelial Cells: Potential Implications for Stroke, COVID-19, Zika, Ebola, Dengue, and Other Viral Infections. Int J Mol Sci. 2022;23: pubmed publisher
Li Y, Wei J, Liu H, Wang K, Jin S, Su Z, et al. An oxygen-adaptive interaction between SNHG12 and occludin maintains blood-brain barrier integrity. Cell Rep. 2022;39:110656 pubmed publisher
Pretorius L, van Staden A, Van der Merwe J, Henning N, Smith C. Alterations to microbial secretome by estrogen may contribute to sex bias in irritable bowel syndrome. Inflammopharmacology. 2022;30:267-281 pubmed publisher
Hua Q, Han Y, Zhao H, Zhang H, Yan B, Pei S, et al. Punicalagin alleviates renal injury via the gut-kidney axis in high-fat diet-induced diabetic mice. Food Funct. 2022;13:867-879 pubmed publisher
Haderer M, Neubert P, Rinner E, Scholtis A, Broncy L, Gschwendtner H, et al. Novel pathomechanism for spontaneous bacterial peritonitis: disruption of cell junctions by cellular and bacterial proteases. Gut. 2022;71:580-592 pubmed publisher
Delaney C, Farrell M, Doherty C, Brennan K, O Keeffe E, Greene C, et al. Attenuated CSF-1R signalling drives cerebrovascular pathology. EMBO Mol Med. 2021;13:e12889 pubmed publisher
Perea García A, Miró P, Jiménez Lorenzo R, Martínez Pastor M, Puig S. Sequential recruitment of the mRNA decay machinery to the iron-regulated protein Cth2 in Saccharomyces cerevisiae. Biochim Biophys Acta Gene Regul Mech. 2020;1863:194595 pubmed publisher
Qian Y, Li Y, Zheng C, Lu T, Sun R, Mao Y, et al. High methylation levels of histone H3 lysine 9 associated with activation of hypoxia-inducible factor 1α (HIF-1α) predict patients' worse prognosis in human hepatocellular carcinomas. Cancer Genet. 2020;245:17-26 pubmed publisher
Heldt N, Seliga A, Winfield M, Gajghate S, Reichenbach N, Yu X, et al. Electronic cigarette exposure disrupts blood-brain barrier integrity and promotes neuroinflammation. Brain Behav Immun. 2020;: pubmed publisher
Evran S, Çalış F, Akkaya E, Baran O, Cevik S, Katar S, et al. The effect of high mobility group box-1 protein on cerebral edema, blood-brain barrier, oxidative stress and apoptosis in an experimental traumatic brain injury model. Brain Res Bull. 2020;154:68-80 pubmed publisher
Hollenstein D, Gómez Sánchez R, Ciftci A, Kriegenburg F, Mari M, Torggler R, et al. Vac8 spatially confines autophagosome formation at the vacuole in S. cerevisiae. J Cell Sci. 2019;132: pubmed publisher
van Drogen F, Mishra R, Rudolf F, Walczak M, Lee S, Reiter W, et al. Mechanical stress impairs pheromone signaling via Pkc1-mediated regulation of the MAPK scaffold Ste5. J Cell Biol. 2019;218:3117-3133 pubmed publisher
Zhou M, Li Y, Lin S, Chen Y, Qian Y, Zhao Z, et al. H3K9me3, H3K36me3, and H4K20me3 Expression Correlates with Patient Outcome in Esophageal Squamous Cell Carcinoma as Epigenetic Markers. Dig Dis Sci. 2019;: pubmed publisher
Zhao C, Shi J, Zhou R, He X, Yang H, Wu Z. DZNep and UNC0642 enhance in vitro developmental competence of cloned pig embryos. Reproduction. 2018;157:359-369 pubmed publisher
Almassy J, Diszházi G, Skaliczki M, Márton I, Magyar Z, Nanasi P, et al. Expression of BK channels and Na+-K+ pumps in the apical membrane of lacrimal acinar cells suggests a new molecular mechanism for primary tear-secretion. Ocul Surf. 2019;17:272-277 pubmed publisher
Stixova L, Komůrková D, Svobodová Kovaříková A, Bartova E. UVA irradiation strengthened an interaction between UBF1/2 proteins and H4K20 di-/tri-methylation. Chromosome Res. 2019;27:41-55 pubmed publisher
Li Y, Guo D, Sun R, Chen P, Qian Q, Fan H. Methylation Patterns of Lys9 and Lys27 on Histone H3 Correlate with Patient Outcome in Gastric Cancer. Dig Dis Sci. 2019;64:439-446 pubmed publisher
Messal N, Fernandez N, Dayot S, Gratio V, Nicole P, Prochasson C, et al. Ectopic expression of OX1R in ulcerative colitis mediates anti-inflammatory effect of orexin-A. Biochim Biophys Acta Mol Basis Dis. 2018;1864:3618-3628 pubmed publisher
Peterson J, Wang D, Shettigar V, Roof S, Canan B, Bakkar N, et al. NF-κB inhibition rescues cardiac function by remodeling calcium genes in a Duchenne muscular dystrophy model. Nat Commun. 2018;9:3431 pubmed publisher
Rom S, Zuluaga Ramirez V, Gajghate S, Seliga A, Winfield M, Heldt N, et al. Hyperglycemia-Driven Neuroinflammation Compromises BBB Leading to Memory Loss in Both Diabetes Mellitus (DM) Type 1 and Type 2 Mouse Models. Mol Neurobiol. 2019;56:1883-1896 pubmed publisher
Kai Y, Li Y, Sun T, Yin W, Mao Y, Li J, et al. A medial prefrontal cortex-nucleus acumens corticotropin-releasing factor circuitry for neuropathic pain-increased susceptibility to opioid reward. Transl Psychiatry. 2018;8:100 pubmed publisher
Li H, Sun J, Du J, Wang F, Fang R, Yu C, et al. Clostridium butyricum exerts a neuroprotective effect in a mouse model of traumatic brain injury via the gut-brain axis. Neurogastroenterol Motil. 2017;: pubmed publisher
Mikuła Pietrasik J, Uruski P, Szubert S, Szpurek D, Sajdak S, Tykarski A, et al. Malignant ascites determine the transmesothelial invasion of ovarian cancer cells. Int J Biochem Cell Biol. 2017;92:6-13 pubmed publisher
Liu W, Schrott Fischer A, Glueckert R, Benav H, Rask Andersen H. The Human "Cochlear Battery" - Claudin-11 Barrier and Ion Transport Proteins in the Lateral Wall of the Cochlea. Front Mol Neurosci. 2017;10:239 pubmed publisher
Romanov N, Hollenstein D, Janschitz M, Ammerer G, Anrather D, Reiter W. Identifying protein kinase-specific effectors of the osmostress response in yeast. Sci Signal. 2017;10: pubmed publisher
Nandakumar V, Hansen N, Glenn H, Han J, Helland S, Hernandez K, et al. Vorinostat differentially alters 3D nuclear structure of cancer and non-cancerous esophageal cells. Sci Rep. 2016;6:30593 pubmed publisher
No J, Choi M, Kwon D, Yoo J, Yang B, Park J, et al. Cell-free extract from porcine induced pluripotent stem cells can affect porcine somatic cell nuclear reprogramming. J Reprod Dev. 2015;61:90-8 pubmed publisher
Krapivinsky G, Krapivinsky L, Manasian Y, Clapham D. The TRPM7 chanzyme is cleaved to release a chromatin-modifying kinase. Cell. 2014;157:1061-72 pubmed publisher
Herraiz A, Belles X, Piulachs M. Chorion formation in panoistic ovaries requires windei and trimethylation of histone 3 lysine 9. Exp Cell Res. 2014;320:46-53 pubmed publisher
Cornacchia D, Dileep V, Quivy J, Foti R, Tili F, Santarella Mellwig R, et al. Mouse Rif1 is a key regulator of the replication-timing programme in mammalian cells. EMBO J. 2012;31:3678-90 pubmed publisher
Tan J, Yang X, Zhuang L, Jiang X, Chen W, Lee P, et al. Pharmacologic disruption of Polycomb-repressive complex 2-mediated gene repression selectively induces apoptosis in cancer cells. Genes Dev. 2007;21:1050-63 pubmed
product information
master code :
NBP1-87402
SKU :
NBP1-87402
product name :
Occludin Antibody - BSA Free
unit size :
0.1 ml (also 25 ul)
description :
The Occludin Antibody - BSA Free from Novus is a rabbit polyclonal antibody to Occludin. This antibody reacts with human,mouse,rat. The Occludin Antibody - BSA Free has been validated for the following applications: Immunocytochemistry/ Immunofluorescence,Western Blot,IF/IHC,Immunohistochemistry,Immunohistochemistry-Paraffin,ELISA,Knockdown Validated.
target :
Occludin
category :
Primary Antibodies
buffer :
PBS (pH 7.2), 40% Glycerol
clonality :
Polyclonal
conjugate :
Unconjugated
host :
Rabbit
immunogen :
DKEHIYDEQPPNVEEWVKNVSAGTQDVPSPPSDYVERVD
SPMAYSSNGKVNDKRFYPESSYKSTPVPEVVQELPLTSP
VDDFRQPRYSSGGNFETPSKRAPAKGRAGRSKRTEQDHY
ETDYTTGGESCDELEED
This antibody was developed against Recombinant Protein corresponding to amino acids:
isotype :
IgG
purity :
Immunogen affinity purified
species :
Human,Mouse,Rat
gene symbol :
OCLN
Antibody validation :
Knockout/Knockdown
applications :
Western Blot,IF/IHC,Immunohistochemistry,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence,ELISA,Knockdown Validated
USD :
599 USD
alt names :
BLCPMG, occludin
storage :
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
more info or order :
company information
Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com
3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.