SUN1 Antibody - BSA Free | Novus Biologicals NBP1-87396 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

SUN1 Antibody - BSA Free

catalog :

NBP1-87396

quantity :

0.1 ml (also 25 ul)

price :

559 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human

application :

western blot, immunohistochemistry, immunocytochemistry, immunoprecipitation, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 12

Published Application/Species/Sample/Dilution	Reference
immunocytochemistry; human; loading ...; fig 5b western blot; human; 1:2000; loading ...; fig 6a	Svobodová Kovaříková A, Bartova E, Kovarik A, Lukasova E. Spatiotemporal Mislocalization of Nuclear Membrane-Associated Proteins in γ-Irradiation-Induced Senescent Cells. Cells. 2020;9: pubmed publisher
immunocytochemistry; human; 1:400; loading ...; fig s3a	Takaki T, Montagner M, Serres M, Le Berre M, Russell M, Collinson L, et al. Actomyosin drives cancer cell nuclear dysmorphia and threatens genome stability. Nat Commun. 2017;8:16013 pubmed publisher
	Gunn A, Yashchenko A, Dubrulle J, Johnson J, Hatch E. A high-content screen reveals new regulators of nuclear membrane stability. Sci Rep. 2024;14:6013 pubmed publisher
	Gunn A, Yashchenko A, Dubrulle J, Johnson J, Hatch E. A high-content screen reveals new regulators of nuclear membrane stability. bioRxiv. 2023;: pubmed publisher
	Park J, Lee E, Moon E, Kim H, Kim I, Hodzic D, et al. Orthodenticle homeobox 2 is transported to lysosomes by nuclear budding vesicles. Nat Commun. 2023;14:1111 pubmed publisher
	Kong Y, Zhang Y, Wang H, Kan W, Guo H, Liu Y, et al. Inner nuclear membrane protein TMEM201 promotes breast cancer metastasis by positive regulating TGFβ signaling. Oncogene. 2022;41:647-656 pubmed publisher
	Procter D, Furey C, Garza Gongora A, Kosak S, Walsh D. Cytoplasmic control of intranuclear polarity by human cytomegalovirus. Nature. 2020;587:109-114 pubmed publisher
	Krisko T, Nicholls H, Bare C, Holman C, Putzel G, Jansen R, et al. Dissociation of Adaptive Thermogenesis from Glucose Homeostasis in Microbiome-Deficient Mice. Cell Metab. 2020;31:592-604.e9 pubmed publisher
	Ringuette Goulet C, Bernard G, Tremblay S, Chabaud S, Bolduc S, Pouliot F. Exosomes Induce Fibroblast Differentiation into Cancer-Associated Fibroblasts through TGFβ Signaling. Mol Cancer Res. 2018;16:1196-1204 pubmed publisher
	Chen M, Arumugam T, Leanage G, Tieng Q, Yadav A, Ullmann J, et al. Disease-modifying effect of intravenous immunoglobulin in an experimental model of epilepsy. Sci Rep. 2017;7:40528 pubmed publisher
	Rog O, Köhler S, Dernburg A. The synaptonemal complex has liquid crystalline properties and spatially regulates meiotic recombination factors. elife. 2017;6: pubmed publisher
	Williams K, Balsor J, Beshara S, Beston B, Jones D, Murphy K. Experience-dependent central vision deficits: Neurobiology and visual acuity. Vision Res. 2015;114:68-78 pubmed publisher

product information

master code :

NBP1-87396

SKU :

NBP1-87396

product name :

SUN1 Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The SUN1 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to SUN1. This antibody reacts with human. The SUN1 Antibody - BSA Free has been validated for the following applications: Western Blot,Immunocytochemistry,Immunocytochemistry/ Immunofluorescence,Immunoprecipitation,Immunohistochemistry,Immunohistochemistry-Paraffin,Simple Western.

target :

SUN1

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

QLLPTVEHLQLELDQLKSELSSWRHVKTGCETVDAVQER
VDVQVREMVKLLFSEDQQGGSLEQLLQRFSSQFVSKGDL
QTMLRDLQLQILRNVTHHVSVTKQLPTSEAVVSAVSEAG
ASGITEAQARAIVNS
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human

gene symbol :

SUN1

Antibody validation :

Independent Anitbodies

accessionNumbers :

O94901

applications :

Western Blot,Immunocytochemistry,Immunocytochemistry/ Immunofluorescence,Immunoprecipitation,Immunohistochemistry,Immunohistochemistry-Paraffin,Simple Western

USD :

559 USD

alt names :

KIAA0810UNC84AFLJ12407, MGC176649, Protein unc-84 homolog A, Sad1 and UNC84 domain containing 1, Sad1 unc-84 domain protein 1, Sad1/unc-84 protein-like 1, SUN domain-containing protein 1, unc-84 homolog A, unc-84 homolog A (C. elegans)

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage