Granulin Antibody - BSA Free | Novus Biologicals NBP1-87324 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

Granulin Antibody - BSA Free

catalog :

NBP1-87324

quantity :

0.1 ml (also 25 ul)

price :

529 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

clone name :

GA2B

reactivity :

human, mouse

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 17

Reference
Kuang L, Hashimoto K, Huang E, Gentry M, Zhu H. Frontotemporal dementia non-sense mutation of progranulin rescued by aminoglycosides. Hum Mol Genet. 2020;29:624-634 pubmed publisher
Nguyen A, Nguyen T, Zhang J, Devireddy S, Zhou P, Karydas A, et al. Murine knockin model for progranulin-deficient frontotemporal dementia with nonsense-mediated mRNA decay. Proc Natl Acad Sci U S A. 2018;115:E2849-E2858 pubmed publisher
Das S, Watanabe S, Hatta M, Noda T, Neumann G, Ozawa M, et al. The highly conserved arginine residues at positions 76 through 78 of influenza A virus matrix protein M1 play an important role in viral replication by affecting the intracellular localization of M1. J Virol. 2012;86:1522-30 pubmed publisher
Liu Y, Massare M, Barnard D, Kort T, Nathan M, Wang L, et al. Chimeric severe acute respiratory syndrome coronavirus (SARS-CoV) S glycoprotein and influenza matrix 1 efficiently form virus-like particles (VLPs) that protect mice against challenge with SARS-CoV. Vaccine. 2011;29:6606-13 pubmed publisher
Doucet J, Forget M, Grange C, Rouxel R, Arbour N, von Messling V, et al. Endogenously expressed matrix protein M1 and nucleoprotein of influenza A are efficiently presented by class I and class II major histocompatibility complexes. J Gen Virol. 2011;92:1162-71 pubmed publisher
Viemann D, Schmolke M, Lueken A, Boergeling Y, Friesenhagen J, Wittkowski H, et al. H5N1 virus activates signaling pathways in human endothelial cells resulting in a specific imbalanced inflammatory response. J Immunol. 2011;186:164-73 pubmed publisher
Eierhoff T, Hrincius E, Rescher U, Ludwig S, Ehrhardt C. The epidermal growth factor receptor (EGFR) promotes uptake of influenza A viruses (IAV) into host cells. PLoS Pathog. 2010;6:e1001099 pubmed publisher
Luig C, Köther K, Dudek S, Gaestel M, Hiscott J, Wixler V, et al. MAP kinase-activated protein kinases 2 and 3 are required for influenza A virus propagation and act via inhibition of PKR. FASEB J. 2010;24:4068-77 pubmed publisher
Wang D, Harmon A, Jin J, Francis D, Christopher Hennings J, Nelson E, et al. The lack of an inherent membrane targeting signal is responsible for the failure of the matrix (M1) protein of influenza A virus to bud into virus-like particles. J Virol. 2010;84:4673-81 pubmed publisher
Schmolke M, Viemann D, Roth J, Ludwig S. Essential impact of NF-kappaB signaling on the H5N1 influenza A virus-induced transcriptome. J Immunol. 2009;183:5180-9 pubmed publisher
Kirkeby S, Martel C, Aasted B. Infection with human H1N1 influenza virus affects the expression of sialic acids of metaplastic mucous cells in the ferret airways. Virus Res. 2009;144:225-32 pubmed publisher
Kang S, Yoo D, Lipatov A, Song J, Davis C, Quan F, et al. Induction of long-term protective immune responses by influenza H5N1 virus-like particles. PLoS ONE. 2009;4:e4667 pubmed publisher
Pauli E, Schmolke M, Wolff T, Viemann D, Roth J, Bode J, et al. Influenza A virus inhibits type I IFN signaling via NF-kappaB-dependent induction of SOCS-3 expression. PLoS Pathog. 2008;4:e1000196 pubmed publisher
Yamamoto Y, Nakamura K, Okamatsu M, Yamada M, Mase M. Avian influenza virus (H5N1) replication in feathers of domestic waterfowl. Emerg Infect Dis. 2008;14:149-51 pubmed publisher
Tanimura N, Tsukamoto K, Okamatsu M, Mase M, Imada T, Nakamura K, et al. Pathology of fatal highly pathogenic H5N1 avian influenza virus infection in large-billed crows (Corvus macrorhynchos) during the 2004 outbreak in Japan. Vet Pathol. 2006;43:500-9 pubmed
Latham T, Galarza J. Formation of wild-type and chimeric influenza virus-like particles following simultaneous expression of only four structural proteins. J Virol. 2001;75:6154-65 pubmed
Reinhardt J, Wolff T. The influenza A virus M1 protein interacts with the cellular receptor of activated C kinase (RACK) 1 and can be phosphorylated by protein kinase C. Vet Microbiol. 2000;74:87-100 pubmed

product information

master code :

NBP1-87324

SKU :

NBP1-87324

product name :

Granulin Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The Granulin Antibody - BSA Free from Novus is a rabbit polyclonal antibody to Granulin. This antibody reacts with human,mouse. The Granulin Antibody - BSA Free has been validated for the following applications: Western Blot,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry,Immunohistochemistry-Paraffin.

target :

Granulin

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

DSQFECPDFSTCCVMVDGSWGCCPMPQASCCEDRVHCCP
HGAFCDLVHTRCITPTGTHPLAKKLPAQRTNRAVALSSS
VMCPDARSRCPDGSTCCELPSGKYGCCPMPNATCCSDHL
HCCPQDTVCDLIQSKCLSKENATTDLL
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human,Mouse

gene symbol :

GRN

Antibody validation :

Orthogonal Validation

applications :

Western Blot,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry,Immunohistochemistry-Paraffin

USD :

529 USD

alt names :

acrogranin, GEP, GP88, granulin, granulin-epithelin, granulins, PC cell-derived growth factor, PCDGF, PEPI, PGRN, proepithelin, progranulin

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage