PDE6A Antibody - BSA Free | Novus Biologicals NBP1-87312 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

PDE6A Antibody - BSA Free

catalog :

NBP1-87312

quantity :

0.1 ml

price :

559 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rhesus macaque

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section, immunohistochemistry - frozen section

more info or order :

Novus Biologicals product webpage

citations: 6

Reference
Liu Z, Chen S, Davis A, Lo C, Wang Q, Li T, et al. Efficient Rescue of Retinal Degeneration in Pde6a Mice by Engineered Base Editing and Prime Editing. Adv Sci (Weinh). 2024;11:e2405628 pubmed publisher
Pavlou M, Babutzka S, Michalakis S. A Bioengineered In Vitro Model to Assess AAV-Based Gene Therapies for Cyclic GMP-Related Disorders. Int J Mol Sci. 2022;23: pubmed publisher
Yamasaki S, Tu H, Matsuyama T, Horiuchi M, Hashiguchi T, Sho J, et al. A Genetic modification that reduces ON-bipolar cells in hESC-derived retinas enhances functional integration after transplantation. iScience. 2022;25:103657 pubmed publisher
Felemban M, Dorgau B, Hunt N, Hallam D, Zerti D, Bauer R, et al. Extracellular matrix component expression in human pluripotent stem cell-derived retinal organoids recapitulates retinogenesis in vivo and reveals an important role for IMPG1 and CD44 in the development of photoreceptors and interphotoreceptor matrix. Acta Biomater. 2018;74:207-221 pubmed publisher
Schön C, Sothilingam V, Mühlfriedel R, Garcia Garrido M, Beck S, Tanimoto N, et al. Gene therapy successfully delays degeneration in a mouse model of PDE6A-linked retinitis pigmentosa (RP 43). Hum Gene Ther. 2017;: pubmed publisher
Sothilingam V, Garcia Garrido M, Jiao K, Buena Atienza E, Sahaboglu A, TrifunoviÄ‡ D, et al. Retinitis pigmentosa: impact of different Pde6a point mutations on the disease phenotype. Hum Mol Genet. 2015;24:5486-99 pubmed publisher

product information

master code :

NBP1-87312

SKU :

NBP1-87312

product name :

PDE6A Antibody - BSA Free

unit size :

0.1 ml

description :

The PDE6A Antibody - BSA Free from Novus is a rabbit polyclonal antibody to PDE6A. This antibody reacts with human,monkey,mouse,primate - macaca mulatta (rhesus macaque). The PDE6A Antibody - BSA Free has been validated for the following applications: IF/IHC,Immunohistochemistry-Frozen,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin.

target :

PDE6A

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

TLMESLTQFLGWSVLNPDTYESMNKLENRKDIFQDIVKY
HVKCDNEEIQKILKTREVYGKEPWECEEEELAEILQAEL
PDADKYEINKFHFSDLPLTELELVKCGIQMYYELKVVDK
FHIPQEALVRFMYSLSKGYRKITYHN
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human,Monkey,Mouse,Primate - Macaca mulatta (Rhesus Macaque)

gene symbol :

PDE6A

Antibody validation :

Independent Anitbodies

applications :

IF/IHC,Immunohistochemistry-Frozen,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin

USD :

559 USD

alt names :

CGPR-A, EC 3.1.4, EC 3.1.4.35, GMP-PDE alpha, PDE V-B1, PDEAcGMP phosphodiesterase alpha subunit, phosphodiesterase 6A, cGMP-specific, rod, alpha, rod cGMP-specific 3'-5'-cyclic phosphodiesterase subunit alpha, rod photoreceptor cGMP phosphodiesterase alpha subunit, RP43

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage