PHGDH Antibody - BSA Free | Novus Biologicals NBP1-87311 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

PHGDH Antibody - BSA Free

catalog :

NBP1-87311

quantity :

0.1 ml (also 25 ul)

price :

559 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

clone name :

2B8

reactivity :

human, mouse, rat

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 14

Reference
Winship A, Griffiths M, Lliberos Requesens C, Sarma U, Phillips K, Hutt K. The PARP inhibitor, olaparib, depletes the ovarian reserve in mice: implications for fertility preservation. Hum Reprod. 2020;35:1864-1874 pubmed publisher
Camberos V, Baio J, Bailey L, Hasaniya N, Lopez L, Kearns Jonker M. Effects of Spaceflight and Simulated Microgravity on YAP1 Expression in Cardiovascular Progenitors: Implications for Cell-Based Repair. Int J Mol Sci. 2019;20: pubmed publisher
Ishida C, Zhang Y, Bianchetti E, Shu C, Nguyen T, Kleiner G, et al. Metabolic Reprogramming by Dual AKT/ERK Inhibition through Imipridones Elicits Unique Vulnerabilities in Glioblastoma. Clin Cancer Res. 2018;24:5392-5406 pubmed publisher
Hernandez I, Baio J, Tsay E, Martinez A, Fuentes T, Bailey L, et al. Short-term hypoxia improves early cardiac progenitor cell function in vitro. Am J Stem Cells. 2018;7:1-17 pubmed
Baio J, Martinez A, Bailey L, Hasaniya N, Pecaut M, Kearns Jonker M. Spaceflight Activates Protein Kinase C Alpha Signaling and Modifies the Developmental Stage of Human Neonatal Cardiovascular Progenitor Cells. Stem Cells Dev. 2018;: pubmed publisher
Baio J, Walden R, Fuentes T, Lee C, Hasaniya N, Bailey L, et al. A Hyper-Crosslinked Carbohydrate Polymer Scaffold Facilitates Lineage Commitment and Maintains a Reserve Pool of Proliferating Cardiovascular Progenitors. Transplant Direct. 2017;3:e153 pubmed publisher
Uchida H, Machida M, Miura T, Kawasaki T, Okazaki T, Sasaki K, et al. A xenogeneic-free system generating functional human gut organoids from pluripotent stem cells. JCI Insight. 2017;2:e86492 pubmed publisher
DeNicola G, Chen P, Mullarky E, Sudderth J, Hu Z, Wu D, et al. NRF2 regulates serine biosynthesis in non-small cell lung cancer. Nat Genet. 2015;47:1475-81 pubmed publisher
Mattaini K, Brignole E, Kini M, Davidson S, Fiske B, Drennan C, et al. An epitope tag alters phosphoglycerate dehydrogenase structure and impairs ability to support cell proliferation. Cancer Metab. 2015;3:5 pubmed publisher
Markkanen E, Fischer R, Ledentcova M, Kessler B, Dianov G. Cells deficient in base-excision repair reveal cancer hallmarks originating from adjustments to genetic instability. Nucleic Acids Res. 2015;43:3667-79 pubmed publisher
Meyer S, Maufort J, Nie J, Stewart R, McIntosh B, Conti L, et al. Development of an efficient targeted cell-SELEX procedure for DNA aptamer reagents. PLoS ONE. 2013;8:e71798 pubmed publisher
Charles N, Hardwick D, Daugas E, Illei G, Rivera J. Basophils and the T helper 2 environment can promote the development of lupus nephritis. Nat Med. 2010;16:701-7 pubmed publisher
Bachelet I, Munitz A, Berent Maoz B, Mankuta D, Levi Schaffer F. Suppression of normal and malignant kit signaling by a bispecific antibody linking kit with CD300a. J Immunol. 2008;180:6064-9 pubmed
Podd B, Thoits J, Whitley N, Cheng H, Kudla K, Taniguchi H, et al. T cells in cryptopatch aggregates share TCR gamma variable region junctional sequences with gamma delta T cells in the small intestinal epithelium of mice. J Immunol. 2006;176:6532-42 pubmed

product information

master code :

NBP1-87311

SKU :

NBP1-87311

product name :

PHGDH Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The PHGDH Antibody - BSA Free from Novus is a rabbit polyclonal antibody to PHGDH. This antibody reacts with human,mouse,rat. The PHGDH Antibody - BSA Free has been validated for the following applications: Simple Western,Western Blot,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry,Immunohistochemistry-Paraffin.

target :

PHGDH

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

LEEIWPLCDFITVHTPLLPSTTGLLNDNTFAQCKKGVRV
VNCARGGIVDEGALLRALQSGQCAGAALDVFTEEPPRDR
ALVDHENVISCPHLGASTKEAQSRCGEEIAVQFVDM
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human,Mouse,Rat

gene symbol :

PHGDH

Antibody validation :

Knockout/Knockdown

applications :

Simple Western,Western Blot,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry,Immunohistochemistry-Paraffin

USD :

559 USD

alt names :

3,3-phosphoglycerate dehydrogenase, 3PGDH, 3-PGDH, D-3-phosphoglycerate dehydrogenase, EC 1.1.1, EC 1.1.1.95, MGC3017, PDG, PGAD, PGD, PGDH, phosphoglycerate dehydrogenase, SERA

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage