PMP70 Antibody - BSA Free | Novus Biologicals NBP1-87258 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

PMP70 Antibody - BSA Free

catalog :

NBP1-87258

quantity :

0.1 ml (also 25 ul)

price :

549 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 9

Reference
Liu S, Fang P, Ke W, Wang J, Wang X, Xiao S, et al. Porcine deltacoronavirus (PDCoV) infection antagonizes interferon-λ1 production. Vet Microbiol. 2020;247:108785 pubmed publisher
Tadokoro H, Hirayama A, Kudo R, Hasebe M, Yoshioka Y, Matsuzaki J, et al. Adenosine leakage from perforin-burst extracellular vesicles inhibits perforin secretion by cytotoxic T-lymphocytes. PLoS ONE. 2020;15:e0231430 pubmed publisher
Guastella A, Michelhaugh S, Klinger N, Fadel H, Kiousis S, Ali Fehmi R, et al. Investigation of the aryl hydrocarbon receptor and the intrinsic tumoral component of the kynurenine pathway of tryptophan metabolism in primary brain tumors. J Neurooncol. 2018;139:239-249 pubmed publisher
Burgoyne T, Lane A, Laughlin W, Cheetham M, Futter C. Correlative light and immuno-electron microscopy of retinal tissue cryostat sections. PLoS ONE. 2018;13:e0191048 pubmed publisher
Zhang Q, Ke H, Blikslager A, Fujita T, Yoo D. Type III Interferon Restriction by Porcine Epidemic Diarrhea Virus and the Role of Viral Protein nsp1 in IRF1 Signaling. J Virol. 2018;92: pubmed publisher
Gerber S, Charif M, Chevrollier A, Chaumette T, Angebault C, Kane M, et al. Mutations in DNM1L, as in OPA1, result in dominant optic atrophy despite opposite effects on mitochondrial fusion and fission. Brain. 2017;140:2586-2596 pubmed publisher
Guastella A, Michelhaugh S, Klinger N, Kupsky W, Polin L, Muzik O, et al. Tryptophan PET Imaging of the Kynurenine Pathway in Patient-Derived Xenograft Models of Glioblastoma. Mol Imaging. 2016;15: pubmed publisher
BosnyÃ¡k E, Kamson D, Guastella A, Varadarajan K, Robinette N, Kupsky W, et al. Molecular imaging correlates of tryptophan metabolism via the kynurenine pathway in human meningiomas. Neuro Oncol. 2015;17:1284-92 pubmed publisher
Reams R, Jones Triche J, Chan O, Hernandez B, Soliman K, Yates C. Immunohistological analysis of ABCD3 expression in Caucasian and African American prostate tumors. Biomed Res Int. 2015;2015:132981 pubmed publisher

product information

master code :

NBP1-87258

SKU :

NBP1-87258

product name :

PMP70 Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The PMP70 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to PMP70. This antibody reacts with human,mouse,porcine. The PMP70 Antibody - BSA Free has been validated for the following applications: IF/IHC,Western Blot,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry,Immunohistochemistry-Paraffin.

target :

PMP70

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

VEGYIYSHCRKVGITLFTVSHRKSLWKHHEYYLHMDGRG
NYEFKQITEDTVEFGS
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human,Mouse,Porcine

gene symbol :

ABCD3

Antibody validation :

Independent Anitbodies

applications :

IF/IHC,Western Blot,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry,Immunohistochemistry-Paraffin

USD :

549 USD

alt names :

70 kDa peroxisomal membrane protein, ABC43, ATP-binding cassette, sub-family D (ALD), member 3, peroxisomal membrane protein 1 (70kD, Zellweger syndrome), Peroxisomal membrane protein-1 (70kD), PMP70ATP-binding cassette sub-family D member 3, PXMP1dJ824O18.1 (ATP-binding cassette, sub-family D (ALD), member 3 (PMP70, PXMP1)), ZWS2

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage