PNK Antibody - BSA Free | Novus Biologicals NBP1-87257 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

PNK Antibody - BSA Free

catalog :

NBP1-87257

quantity :

0.1 ml (also 25 ul)

price :

549 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 8

Reference
Tsukada K, Shimada M, Imamura R, Saikawa K, Ishiai M, Matsumoto Y. The FHA domain of PNKP is essential for its recruitment to DNA damage sites and maintenance of genome stability. Mutat Res. 2020;822:111727 pubmed publisher
Tsukada K, Matsumoto Y, Shimada M. Linker region is required for efficient nuclear localization of polynucleotide kinase phosphatase. PLoS ONE. 2020;15:e0239404 pubmed publisher
Yip M, Keszei A, Feng Q, Chu V, McKenna M, Shao S. Mechanism for recycling tRNAs on stalled ribosomes. Nat Struct Mol Biol. 2019;26:343-349 pubmed publisher
Gao R, Chakraborty A, Geater C, Pradhan S, Gordon K, Snowden J, et al. Mutant huntingtin impairs PNKP and ATXN3, disrupting DNA repair and transcription. elife. 2019;8: pubmed publisher
Maertens O, Kuzmickas R, Manchester H, Emerson C, Gavin A, Guild C, et al. MAPK Pathway Suppression Unmasks Latent DNA Repair Defects and Confers a Chemical Synthetic Vulnerability in BRAF-, NRAS-, and NF1-Mutant Melanomas. Cancer Discov. 2019;9:526-545 pubmed publisher
Zagorac I, Fernandez Gaitero S, Penning R, Post H, Bueno M, Mouron S, et al. In vivo phosphoproteomics reveals kinase activity profiles that predict treatment outcome in triple-negative breast cancer. Nat Commun. 2018;9:3501 pubmed publisher
Rosen M, Jeffay S, Nichols H, Hoopes M, Hunter E. ATP Binding Cassette Sub-family Member 2 (ABCG2) and Xenobiotic Exposure During Early Mouse Embryonic Stem Cell Differentiation. Birth Defects Res. 2017;: pubmed publisher
Shimada M, Dumitrache L, Russell H, McKinnon P. Polynucleotide kinase-phosphatase enables neurogenesis via multiple DNA repair pathways to maintain genome stability. EMBO J. 2015;34:2465-80 pubmed publisher

product information

master code :

NBP1-87257

SKU :

NBP1-87257

product name :

PNK Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The PNK Antibody - BSA Free from Novus is a rabbit polyclonal antibody to PNK. This antibody reacts with human,mouse. The PNK Antibody - BSA Free has been validated for the following applications: IF/IHC,Western Blot,Knockout Validated,Knockdown Validated,Immunohistochemistry,Immunohistochemistry-Paraffin,Simple Western,Immunocytochemistry/ Immunofluorescence.

target :

PNK

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

PETRTVAVKQLGVNPSTTGTQELKPGLEGSLGVGDTLYL
VNGLHPLTLRWEETRTPESQPDTPPGTPLVSQDEKRDAE
LPKKRMRKSNPGWENLEKLLVFTAAGVKPQGKVAGFDLD
GTLITTRSGKVFPTGP
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human,Mouse

gene symbol :

PNKP

Antibody validation :

Knockout/Knockdown

applications :

IF/IHC,Western Blot,Knockout Validated,Knockdown Validated,Immunohistochemistry,Immunohistochemistry-Paraffin,Simple Western,Immunocytochemistry/ Immunofluorescence

USD :

549 USD

alt names :

DNA 5'-kinase/3'-phosphatase, EIEE10, Homo sapiens polynucleotide kinase 3'-phosphatase (PNKP), MCSZ, PNKbifunctional polynucleotide phosphatase/kinase, polynucleotide kinase 3'-phosphatase, Polynucleotide kinase-3'-phosphatase

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage