RAP80 Antibody - BSA Free | Novus Biologicals NBP1-87156 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

RAP80 Antibody - BSA Free

catalog :

NBP1-87156

quantity :

0.1 ml (also 25 ul)

price :

559 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 9

Published Application/Species/Sample/Dilution	Reference
immunocytochemistry; human; fig 1	Renaud E, Barascu A, Rosselli F. Impaired TIP60-mediated H4K16 acetylation accounts for the aberrant chromatin accumulation of 53BP1 and RAP80 in Fanconi anemia pathway-deficient cells. Nucleic Acids Res. 2016;44:648-56 pubmed publisher
	Jiang Q, Foglizzo M, Morozov Y, Yang X, Datta A, Tian L, et al. Autologous K63 deubiquitylation within the BRCA1-A complex licenses DNA damage recognition. J Cell Biol. 2022;221: pubmed publisher
	Sherker A, Chaudhary N, Adam S, Heijink A, Noordermeer S, Fradet Turcotte A, et al. Two redundant ubiquitin-dependent pathways of BRCA1 localization to DNA damage sites. EMBO Rep. 2021;22:e53679 pubmed publisher
	Nakamura K, Kustatscher G, Alabert C, Hödl M, Forne I, Völker Albert M, et al. Proteome dynamics at broken replication forks reveal a distinct ATM-directed repair response suppressing DNA double-strand break ubiquitination. Mol Cell. 2021;: pubmed publisher
	Bodo S, Campagne C, Thin T, Higginson D, Vargas H, Hua G, et al. Single-dose radiotherapy disables tumor cell homologous recombination via ischemia/reperfusion injury. J Clin Invest. 2019;129:786-801 pubmed publisher
	Yasuhara T, Kato R, Hagiwara Y, Shiotani B, Yamauchi M, Nakada S, et al. Human Rad52 Promotes XPG-Mediated R-loop Processing to Initiate Transcription-Associated Homologous Recombination Repair. Cell. 2018;175:558-570.e11 pubmed publisher
	Watanabe S, Iimori M, Chan D, Hara E, Kitao H, Maehara Y. MDC1 methylation mediated by lysine methyltransferases EHMT1 and EHMT2 regulates active ATM accumulation flanking DNA damage sites. Sci Rep. 2018;8:10888 pubmed publisher
	Baranes Bachar K, Levy Barda A, Oehler J, Reid D, Soria Bretones I, Voss T, et al. The Ubiquitin E3/E4 Ligase UBE4A Adjusts Protein Ubiquitylation and Accumulation at Sites of DNA Damage, Facilitating Double-Strand Break Repair. Mol Cell. 2018;69:866-878.e7 pubmed publisher
	Ha K, Ma C, Lin H, Tang L, Lian Z, Zhao F, et al. The anaphase promoting complex impacts repair choice by protecting ubiquitin signalling at DNA damage sites. Nat Commun. 2017;8:15751 pubmed publisher

product information

master code :

NBP1-87156

SKU :

NBP1-87156

product name :

RAP80 Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The RAP80 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to RAP80. This antibody reacts with human,mouse. The RAP80 Antibody - BSA Free has been validated for the following applications: Western Blot,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry-Paraffin,Immunomicroscopy,Immunohistochemistry.

target :

RAP80

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

LLRKAIAESLNSCRPSDASATRSRPLATGPSSQSHQEKT
TDSGLTEGIWQLVPPSLFKGSHISQGNEAEEREEPWDHT
EKTEEEPVSGSSG
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human,Mouse

gene symbol :

UIMC1

Antibody validation :

Independent Anitbodies

accessionNumbers :

Q96RL1

applications :

Western Blot,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry-Paraffin,Immunomicroscopy,Immunohistochemistry

USD :

559 USD

alt names :

BRCA1-A complex subunit RAP80, RAP80X2HRIP110, receptor associated protein 80, Receptor-associated protein 80, retinoid x receptor interacting protein, Retinoid X receptor-interacting protein 110, RXRIP110, ubiquitin interaction motif containing 1, Ubiquitin interaction motif-containing protein 1

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage