S100B Antibody - BSA Free | Novus Biologicals NBP1-87102 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

S100B Antibody - BSA Free

catalog :

NBP1-87102

quantity :

0.1 ml (also 25 ul)

price :

569 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

clone name :

MEM-61

reactivity :

human, mouse, rat

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 16

Reference
Gonzalez H, Narasipura S, Shull T, Shetty A, Teppen T, Naqib A, et al. An Efficient and Cost-Effective Approach to Generate Functional Human Inducible Pluripotent Stem Cell-Derived Astrocytes. Cells. 2023;12: pubmed publisher
Horowitch B, Lee D, Ding M, Martinez Morilla S, Aung T, Ouerghi F, et al. Subsets of IFN Signaling Predict Response to Immune Checkpoint Blockade in Patients with Melanoma. Clin Cancer Res. 2023;29:2908-2918 pubmed publisher
Plebanek M, Xue Y, Nguyen Y, Devito N, Wang X, Holtzhausen A, et al. A SREBF2-dependent gene program drives an immunotolerant dendritic cell population during cancer progression. bioRxiv. 2023;: pubmed publisher
Konstantinidis E, Dakhel A, Beretta C, Erlandsson A. Long-term effects of amyloid-beta deposits in human iPSC-derived astrocytes. Mol Cell Neurosci. 2023;125:103839 pubmed publisher
Theivanthiran B, Yarla N, Haykal T, Nguyen Y, Cao L, Ferreira M, et al. Tumor-intrinsic NLRP3-HSP70-TLR4 axis drives premetastatic niche development and hyperprogression during anti-PD-1 immunotherapy. Sci Transl Med. 2022;14:eabq7019 pubmed publisher
Bogdanov L, Shishkova D, Mukhamadiyarov R, Velikanova E, Tsepokina A, Terekhov A, et al. Excessive Adventitial and Perivascular Vascularisation Correlates with Vascular Inflammation and Intimal Hyperplasia. Int J Mol Sci. 2022;23: pubmed publisher
Kim H, Lee S, Lim J, Yoo J, Hwang D. The epidermal growth factor receptor variant type III mutation frequently found in gliomas induces astrogenesis in human cerebral organoids. Cell Prolif. 2021;54:e12965 pubmed publisher
Halder L, Jo E, Hasan M, Ferreira Gomes M, Krüger T, Westermann M, et al. Immune modulation by complement receptor 3-dependent human monocyte TGF-β1-transporting vesicles. Nat Commun. 2020;11:2331 pubmed publisher
Sun D, Hu T. A low cost mobile phone dark-field microscope for nanoparticle-based quantitative studies. Biosens Bioelectron. 2018;99:513-518 pubmed publisher
KrjutÅ¡kov K, Katayama S, Saare M, Vera Rodriguez M, Lubenets D, Samuel K, et al. Single-cell transcriptome analysis of endometrial tissue. Hum Reprod. 2016;31:844-53 pubmed publisher
Zhou L, Cui X, Su K, Wang X, Guo J. Beneficial reciprocal effects of bone marrow stromal cells and Schwann cells from adult rats in a dynamic coâ€‘culture system in vitro without intercellular contact. Mol Med Rep. 2015;12:4931-8 pubmed publisher
Saare M, Rekker K, Laisk Podar T, Sõritsa D, Roost A, Simm J, et al. High-throughput sequencing approach uncovers the miRNome of peritoneal endometriotic lesions and adjacent healthy tissues. PLoS ONE. 2014;9:e112630 pubmed publisher
Bronisz A, Wang Y, Nowicki M, Peruzzi P, Ansari K, Ogawa D, et al. Extracellular vesicles modulate the glioblastoma microenvironment via a tumor suppression signaling network directed by miR-1. Cancer Res. 2014;74:738-750 pubmed publisher
Lafleur M, Xu D, Hemler M. Tetraspanin proteins regulate membrane type-1 matrix metalloproteinase-dependent pericellular proteolysis. Mol Biol Cell. 2009;20:2030-40 pubmed publisher
Singh A, Sugimoto K, Dhawan P, Harris R. Juxtacrine activation of EGFR regulates claudin expression and increases transepithelial resistance. Am J Physiol Cell Physiol. 2007;293:C1660-8 pubmed
Stockl J, Majdic O, Fischer G, Maurer D, Knapp W. Monomorphic molecules function as additional recognition structures on haptenated target cells for HLA-A1-restricted, hapten-specific CTL. J Immunol. 2001;167:2724-33 pubmed

product information

master code :

NBP1-87102

SKU :

NBP1-87102

product name :

S100B Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The S100B Antibody - BSA Free from Novus is a rabbit polyclonal antibody to S100B. This antibody reacts with human,mouse,rat. The S100B Antibody - BSA Free has been validated for the following applications: IF/IHC,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry.

target :

S100B

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

LEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELS
HFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMV
TTACHEFFEHE
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human,Mouse,Rat

gene symbol :

S100B

Antibody validation :

Orthogonal Validation

applications :

IF/IHC,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry

USD :

569 USD

alt names :

beta (neural), NEF, S100, S100 beta, S100 calcium binding protein B, S100 calcium-binding protein B, S100 calcium-binding protein, beta (neural), S-100 calcium-binding protein, beta chain, 10protein S100-B, S-100 protein beta chain, S-100 protein subunit beta, S100beta

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage