SDHB Antibody - BSA Free | Novus Biologicals NBP1-87069 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

SDHB Antibody - BSA Free

catalog :

NBP1-87069

quantity :

0.1 ml (also 25 ul)

price :

559 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 7

Reference
Kang K, Ko J, Lee H, Shin S, Lee W, Hong J, et al. Surgically Metabolic Resection of Pericardial Fat to Ameliorate Myocardial Mitochondrial Dysfunction in Acute Myocardial Infarction Obese Rats. J Korean Med Sci. 2022;37:e55 pubmed publisher
Kasza I, Adler D, Nelson D, Eric Yen C, Dumas S, Ntambi J, et al. Evaporative cooling provides a major metabolic energy sink. Mol Metab. 2019;27:47-61 pubmed publisher
LISTENBERGER L, Townsend E, Rickertsen C, Hains A, Brown E, Inwards E, et al. Decreasing Phosphatidylcholine on the Surface of the Lipid Droplet Correlates with Altered Protein Binding and Steatosis. Cells. 2018;7: pubmed publisher
Finlin B, Memetimin H, Confides A, Kasza I, Zhu B, Vekaria H, et al. Human adipose beiging in response to cold and mirabegron. JCI Insight. 2018;3: pubmed publisher
Maisano M, Cappello T, Oliva S, Natalotto A, Giannetto A, Parrino V, et al. PCB and OCP accumulation and evidence of hepatic alteration in the Atlantic bluefin tuna, T. thynnus, from the Mediterranean Sea. Mar Environ Res. 2016;121:40-8 pubmed publisher
Papathomas T, Oudijk L, Persu A, Gill A, van Nederveen F, Tischler A, et al. SDHB/SDHA immunohistochemistry in pheochromocytomas and paragangliomas: a multicenter interobserver variation analysis using virtual microscopy: a Multinational Study of the European Network for the Study of Adrenal Tumors (ENS@T). Mod Pathol. 2015;28:807-21 pubmed publisher
Desmurs M, Foti M, Raemy E, Vaz F, Martinou J, Bairoch A, et al. C11orf83, a mitochondrial cardiolipin-binding protein involved in bc1 complex assembly and supercomplex stabilization. Mol Cell Biol. 2015;35:1139-56 pubmed publisher

product information

master code :

NBP1-87069

SKU :

NBP1-87069

product name :

SDHB Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The SDHB Antibody - BSA Free from Novus is a rabbit polyclonal antibody to SDHB. This antibody reacts with human,mouse,rat. The SDHB Antibody - BSA Free has been validated for the following applications: IF/IHC,Western Blot,Immunohistochemistry,Immunohistochemistry-Paraffin,Simple Western,Knockdown Validated,Immunocytochemistry/ Immunofluorescence.

target :

SDHB

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

EGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNG
DKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYR
CHTIMNCTRTCPKGLNPGKAIAEIKKMMATY
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human,Mouse,Rat

theoretical molecular weight :

28 kDa

gene symbol :

SDHB

Antibody validation :

Knockout/Knockdown

applications :

IF/IHC,Western Blot,Immunohistochemistry,Immunohistochemistry-Paraffin,Simple Western,Knockdown Validated,Immunocytochemistry/ Immunofluorescence

USD :

559 USD

alt names :

EC 1.3.5.1, FLJ92337, IP, Iron-sulfur subunit of complex II, PGL4, SDH, SDH1, SDH2, SDHIP, succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial, succinate dehydrogenase complex, subunit B, iron sulfur (Ip)

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage