product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
TRAP alpha Antibody - BSA Free
catalog :
NBP1-86912
quantity :
0.1 ml (also 25 ul)
price :
559 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat, roundworm
application :
western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section
more info or order :
citations: 5
Reference
Tarab Ravski D, Hazan Halevy I, Goldsmith M, Stotsky Oterin L, Breier D, Naidu G, et al. Delivery of Therapeutic RNA to the Bone Marrow in Multiple Myeloma Using CD38-Targeted Lipid Nanoparticles. Adv Sci (Weinh). 2023;10:e2301377 pubmed publisher
Li X, Itani O, Haataja L, Dumas K, Yang J, Cha J, et al. Requirement for translocon-associated protein (TRAP) α in insulin biogenesis. Sci Adv. 2019;5:eaax0292 pubmed publisher
Tessier S, Madhu V, Johnson Z, Shapiro I, Risbud M. NFAT5/TonEBP controls early acquisition of notochord phenotypic markers, collagen composition, and sonic hedgehog signaling during mouse intervertebral disc embryogenesis. Dev Biol. 2019;: pubmed publisher
Morales Hernández A, Nacarino Palma A, Moreno Marín N, Barrasa E, Paniagua Quiñones B, Catalina Fernandez I, et al. Lung regeneration after toxic injury is improved in absence of dioxin receptor. Stem Cell Res. 2017;25:61-71 pubmed publisher
Palacio Mancheno P, Evashwick Rogler T, Laudier D, Purmessur D, Iatridis J. Hyperosmolarity induces notochordal cell differentiation with aquaporin3 upregulation and reduced N-cadherin expression. J Orthop Res. 2018;36:788-798 pubmed publisher
product information
brand :
Novus
catalog number base :
NBP1-86912
SKU :
NBP1-86912
product name :
TRAP alpha Antibody - BSA Free
units size :
0.1 ml (also 25 ul)
description :
The TRAP alpha Antibody - BSA Free from Novus is a rabbit polyclonal antibody to TRAP alpha. This antibody reacts with c. elegans,human,mouse,rat,nematode - caenorhabditis elegans. The TRAP alpha Antibody - BSA Free has been validated for the following applications: Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence.
target :
TRAP alpha
category :
Primary Antibodies
buffer :
PBS (pH 7.2) and 40% Glycerol
clonality :
Polyclonal
conjugate :
Unconjugated
all_available conjugate :
Unconjugated
host :
Rabbit
immunogen :
ESRKRKRPIQKVEMGTSSQNDVDMSWIPQETLNQINKAS
PRRLPRKRAQKRSVGSDE
This antibody was developed against Recombinant Protein corresponding to amino acids:
isotype :
IgG
purity :
Immunogen affinity purified
species :
C. elegans,Human,Mouse,Rat,Nematode - Caenorhabditis elegans
gene symbol :
SSR1
Antibody validation :
Independent Anitbodies
top caption :
Immunocytochemistry/ Immunofluorescence: TRAP alpha Antibody [NBP1-86912]
applications :
Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence
USD :
559 USD
alt names :
DKFZp781N23103, FLJ14232, FLJ22100, FLJ23034, FLJ78242, FLJ93042, signal sequence receptor, alpha, SSR alpha subunit, SSR-alpha, translocon-associated protein alpha subunit, translocon-associated protein subunit alpha, TRAP alpha, TRAP-alpha, TRAPASignal sequence receptor subunit alpha
storage :
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
more info or order :
company information
Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com
3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.