TRAP alpha Antibody - BSA Free | Novus Biologicals NBP1-86912 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

TRAP alpha Antibody - BSA Free

catalog :

NBP1-86912

quantity :

0.1 ml (also 25 ul)

price :

559 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, roundworm

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 5

Reference
Tarab Ravski D, Hazan Halevy I, Goldsmith M, Stotsky Oterin L, Breier D, Naidu G, et al. Delivery of Therapeutic RNA to the Bone Marrow in Multiple Myeloma Using CD38-Targeted Lipid Nanoparticles. Adv Sci (Weinh). 2023;10:e2301377 pubmed publisher
Li X, Itani O, Haataja L, Dumas K, Yang J, Cha J, et al. Requirement for translocon-associated protein (TRAP) α in insulin biogenesis. Sci Adv. 2019;5:eaax0292 pubmed publisher
Tessier S, Madhu V, Johnson Z, Shapiro I, Risbud M. NFAT5/TonEBP controls early acquisition of notochord phenotypic markers, collagen composition, and sonic hedgehog signaling during mouse intervertebral disc embryogenesis. Dev Biol. 2019;: pubmed publisher
Morales Hernández A, Nacarino Palma A, Moreno Marín N, Barrasa E, Paniagua Quiñones B, Catalina Fernandez I, et al. Lung regeneration after toxic injury is improved in absence of dioxin receptor. Stem Cell Res. 2017;25:61-71 pubmed publisher
Palacio Mancheno P, Evashwick Rogler T, Laudier D, Purmessur D, Iatridis J. Hyperosmolarity induces notochordal cell differentiation with aquaporin3 upregulation and reduced N-cadherin expression. J Orthop Res. 2018;36:788-798 pubmed publisher

product information

master code :

NBP1-86912

SKU :

NBP1-86912

product name :

TRAP alpha Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The TRAP alpha Antibody - BSA Free from Novus is a rabbit polyclonal antibody to TRAP alpha. This antibody reacts with c. elegans,human,mouse,rat,nematode - caenorhabditis elegans. The TRAP alpha Antibody - BSA Free has been validated for the following applications: Immunohistochemistry,Immunocytochemistry/ Immunofluorescence,Western Blot,Immunohistochemistry-Paraffin.

target :

TRAP alpha

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

ESRKRKRPIQKVEMGTSSQNDVDMSWIPQETLNQINKAS
PRRLPRKRAQKRSVGSDE
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

C. elegans,Human,Mouse,Rat,Nematode - Caenorhabditis elegans

gene symbol :

SSR1

Antibody validation :

Independent Anitbodies

applications :

Immunohistochemistry,Immunocytochemistry/ Immunofluorescence,Western Blot,Immunohistochemistry-Paraffin

USD :

559 USD

alt names :

DKFZp781N23103, FLJ14232, FLJ22100, FLJ23034, FLJ78242, FLJ93042, signal sequence receptor, alpha, SSR alpha subunit, SSR-alpha, translocon-associated protein alpha subunit, translocon-associated protein subunit alpha, TRAP alpha, TRAP-alpha, TRAPASignal sequence receptor subunit alpha

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage