CYC1 Antibody - BSA Free | Novus Biologicals NBP1-86872 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

CYC1 Antibody - BSA Free

catalog :

NBP1-86872

quantity :

0.1 ml (also 25 ul)

price :

559 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 6

Reference
Solvik T, Nguyen T, Tony Lin Y, Marsh T, Huang E, Wiita A, et al. Secretory autophagy maintains proteostasis upon lysosome inhibition. J Cell Biol. 2022;221: pubmed publisher
Spoorthi B, More S, Gautham S, Ghosh S, Saha I, Maiti A. Role of free radical scavenging activity of vasoactive intestinal peptide in the attenuation of mitochondrial dysfunction to ameliorate dextran sulphate sodium-induced colitis in mice: Implications in ulcerative colitis. J Dig Dis. 2020;21:711-723 pubmed publisher
Maiti A, Sharba S, Navabi N, Linden S. Colonic levels of vasoactive intestinal peptide decrease during infection and exogenous VIP protects epithelial mitochondria against the negative effects of IFNγ and TNFα induced during Citrobacter rodentium infection. PLoS ONE. 2018;13:e0204567 pubmed publisher
Chishiki M, Takagi K, Sato A, Miki Y, Yamamoto Y, Ebata A, et al. Cytochrome c1 in ductal carcinoma in situ of breast associated with proliferation and comedo necrosis. Cancer Sci. 2017;108:1510-1519 pubmed publisher
Maiti A, Sharba S, Navabi N, Forsman H, Fernandez H, Linden S. IL-4 Protects the Mitochondria Against TNFα and IFNγ Induced Insult During Clearance of Infection with Citrobacter rodentium and Escherichia coli. Sci Rep. 2015;5:15434 pubmed publisher
Desmurs M, Foti M, Raemy E, Vaz F, Martinou J, Bairoch A, et al. C11orf83, a mitochondrial cardiolipin-binding protein involved in bc1 complex assembly and supercomplex stabilization. Mol Cell Biol. 2015;35:1139-56 pubmed publisher

product information

master code :

NBP1-86872

SKU :

NBP1-86872

product name :

CYC1 Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The CYC1 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to CYC1. This antibody reacts with human,mouse,rat. The CYC1 Antibody - BSA Free has been validated for the following applications: IF/IHC,Western Blot,Immunohistochemistry-Paraffin,Immunohistochemistry,Immunocytochemistry/ Immunofluorescence.

target :

CYC1

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

NSEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYC
EPPTGVSLREGLYFNPYFPGQAIAMAPPIYTDVLEFDDG
TPATMSQIAKDVCTFLRWASEPEHDHRKRMGLKMLMMMA
LLVPLVYTIKRHKWSVLKSRKLAYR
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human,Mouse,Rat

gene symbol :

CYC1

Antibody validation :

Orthogonal Validation

applications :

IF/IHC,Western Blot,Immunohistochemistry-Paraffin,Immunohistochemistry,Immunocytochemistry/ Immunofluorescence

USD :

559 USD

alt names :

Complex III subunit 4, Complex III subunit IV, cytochrome c1, heme protein, mitochondrial, cytochrome c-1Cytochrome b-c1 complex subunit 4, Ubiquinol-cytochrome-c reductase complex cytochrome c1 subunit, UQCR4

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage