Tight Junction Protein 2 Antibody - BSA Free | Novus Biologicals NBP1-86850 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

Tight Junction Protein 2 Antibody - BSA Free

catalog :

NBP1-86850

quantity :

0.1 ml (also 25 ul)

price :

549 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

clone name :

2J10D7

reactivity :

human, mouse

application :

western blot, immunohistochemistry, immunocytochemistry, immunoprecipitation, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 6

Reference
Kurt B, Ozleyen A, Antika G, Yilmaz Y, Tumer T. Multitarget Profiling of a Strigolactone Analogue for Early Events of Alzheimer's Disease: In Vitro Therapeutic Activities against Neuroinflammation. ACS Chem Neurosci. 2020;11:501-507 pubmed publisher
Duran Y, Karaboga I. Effect of hesperetin on systemic inflammation and hepatic injury after blunt chest trauma in rats. Biotech Histochem. 2020;95:297-304 pubmed publisher
Chen Y, Chen C, Wang S, Lin Y, Chen W, Tsai M, et al. Downregulation of tight junction protein zonula occludens-2 and urothelium damage in a cyclophosphamide-induced mouse model of cystitis. Taiwan J Obstet Gynecol. 2018;57:399-406 pubmed publisher
Hsiao H, Fernandez R, Tanaka S, Li W, Spahn J, Chiu S, et al. Spleen-derived classical monocytes mediate lung ischemia-reperfusion injury through IL-1β. J Clin Invest. 2018;128:2833-2847 pubmed publisher
Chen H, Chen C, Chen W, Wang S, Chen Y. A promising protein responsible for overactive bladder in ovariectomized mice. Taiwan J Obstet Gynecol. 2017;56:196-203 pubmed publisher
Santhi W, Sebastian P, Varghese B, Prakash O, Pillai M. NF-kappaB and COX-2 during oral tumorigenesis and in assessment of minimal residual disease in surgical margins. Exp Mol Pathol. 2006;81:123-30 pubmed

product information

master code :

NBP1-86850

SKU :

NBP1-86850

product name :

Tight Junction Protein 2 Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The Tight Junction Protein 2 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to Tight Junction Protein 2. This antibody reacts with human,mouse. The Tight Junction Protein 2 Antibody - BSA Free has been validated for the following applications: IF/IHC,Western Blot,Immunohistochemistry,Immunoprecipitation,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence.

target :

Tight Junction Protein 2

category :

Primary Antibodies

buffer :

PBS (pH 7.2), 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

IGVLLMKSRANEEYGLRLGSQIFVKEMTRTGLATKDGNL
HEGDIILKINGTVTENMSLTDARKLIEKSRGKLQLVVLR
DSQQTLINIPSLNDSDSEIEDISEIESNRSFSPEERRHQ
YSDYDYHSSSEKLKERPSSREDTPSRLSRMG
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human,Mouse

gene symbol :

TJP2

Antibody validation :

Orthogonal Validation

applications :

IF/IHC,Western Blot,Immunohistochemistry,Immunoprecipitation,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence

USD :

549 USD

alt names :

C9DUPq21.11, DFNA51, DUP9q21.11, MGC26306, Tight junction protein 2, tight junction protein 2 (zona occludens 2), TJP2, X104, X104tight junction protein ZO-2, ZO2, ZO-2, ZO2Friedreich ataxia region gene X104 (tight junction protein ZO-2), Zona occludens protein 2, Zonula occludens protein 2

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage