cGAS Antibody - BSA Free | Novus Biologicals NBP1-86761 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

cGAS Antibody - BSA Free

catalog :

NBP1-86761

quantity :

0.1 ml (also 25 ul)

price :

579 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 11

Reference
Li K, Gong Y, Qiu D, Tang H, Zhang J, Yuan Z, et al. Hyperbaric oxygen facilitates teniposide-induced cGAS-STING activation to enhance the antitumor efficacy of PD-1 antibody in HCC. J Immunother Cancer. 2022;10: pubmed publisher
Lohinai Z, DORA D, Caldwell C, Rivard C, Suda K, Yu H, et al. Loss of STING expression is prognostic in non-small cell lung cancer. J Surg Oncol. 2022;125:1042-1052 pubmed publisher
Deater M, Tamhankar M, Lloyd R. TDRD3 is an antiviral restriction factor that promotes IFN signaling with G3BP1. PLoS Pathog. 2022;18:e1010249 pubmed publisher
Berndt N, Wolf C, Fischer K, Cura Costa E, Knuschke P, Zimmermann N, et al. Photosensitivity and cGAS-Dependent IFN-1 Activation in Patients with Lupus and TREX1 Deficiency. J Invest Dermatol. 2022;142:633-640.e6 pubmed publisher
Luzwick J, Dombi E, Boisvert R, Roy S, Park S, Kunnimalaiyaan S, et al. MRE11-dependent instability in mitochondrial DNA fork protection activates a cGAS immune signaling pathway. Sci Adv. 2021;7:eabf9441 pubmed publisher
Schwertner B, Lindner G, Toledo Stauner C, Klapproth E, Magnus C, Rohrhofer A, et al. Nectin-1 Expression Correlates with the Susceptibility of Malignant Melanoma to Oncolytic Herpes Simplex Virus In Vitro and In Vivo. Cancers (Basel). 2021;13: pubmed publisher
Chen H, Zhang J, Wang Y, Simoneau A, Yang H, Levine A, et al. cGAS suppresses genomic instability as a decelerator of replication forks. Sci Adv. 2020;6: pubmed publisher
Verrier E, Yim S, Heydmann L, El Saghire H, Bach C, Turon Lagot V, et al. Hepatitis B Virus Evasion From Cyclic Guanosine Monophosphate-Adenosine Monophosphate Synthase Sensing in Human Hepatocytes. Hepatology. 2018;68:1695-1709 pubmed publisher
Schuelke J, Meyers N, Reitmaier S, Klose S, Ignatius A, Claes L. Intramembranous bone formation after callus distraction is augmented by increasing axial compressive strain. PLoS ONE. 2018;13:e0195466 pubmed publisher
Jeon J, Kang L, Lee K, Cho C, Song E, Kim W, et al. 3'-Sialyllactose protects against osteoarthritic development by facilitating cartilage homeostasis. J Cell Mol Med. 2018;22:57-66 pubmed publisher
Antunes J, Tsaryk R, Gonçalves R, Pereira C, Landes C, Brochhausen C, et al. Poly(γ-Glutamic Acid) as an Exogenous Promoter of Chondrogenic Differentiation of Human Mesenchymal Stem/Stromal Cells. Tissue Eng Part A. 2015;21:1869-85 pubmed publisher

product information

master code :

NBP1-86761

SKU :

NBP1-86761

product name :

cGAS Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The cGAS Antibody - BSA Free from Novus is a rabbit polyclonal antibody to cGAS. This antibody reacts with human. The cGAS Antibody - BSA Free has been validated for the following applications: Western Blot,Immunohistochemistry-Paraffin,Immunohistochemistry,Immunocytochemistry/ Immunofluorescence,IF/IHC,Simple Western.

target :

cGAS

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

RKQLRLKPFYLVPKHAKEGNGFQEETWRLSFSHIEKEIL
NNHGKSKTCCENKEEKCCRKDCLKLMKYLLEQLKERF
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human

gene symbol :

CGAS

Antibody validation :

Orthogonal Validation

applications :

Immunohistochemistry-Paraffin,Immunohistochemistry,Immunocytochemistry/ Immunofluorescence,IF/IHC,Western Blot,Simple Western

USD :

579 USD

alt names :

C6orf150, c-GAS, cyclic GMP-AMP synthase, h-cGAS, Mab-21 domain containing 1

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage