CACNA2D1 Antibody - BSA Free | Novus Biologicals NBP1-86683 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

CACNA2D1 Antibody - BSA Free

catalog :

NBP1-86683

quantity :

0.1 ml (also 25 ul)

price :

559 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse

application :

immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section, immunohistochemistry - frozen section

more info or order :

Novus Biologicals product webpage

citations: 6

Reference
Cui W, Chu Y, Xu F, Chen T, Gao L, Feng Y, et al. Calcium Channel α2δ1 Subunit Mediates Secondary Orofacial Hyperalgesia Through PKC-TRPA1/Gap Junction Signaling. J Pain. 2019;: pubmed publisher
Maitland M, Onea G, Chiasson C, Wang X, Ma J, Moor S, et al. The mammalian CTLH complex is an E3 ubiquitin ligase that targets its subunit muskelin for degradation. Sci Rep. 2019;9:9864 pubmed publisher
McTavish C, Bérubé Janzen W, Wang X, Maitland M, Salemi L, Hess D, et al. Regulation of c-Raf Stability through the CTLH Complex. Int J Mol Sci. 2019;20: pubmed publisher
Salemi L, Maitland M, Yefet E, Schild Poulter C. Inhibition of HDAC6 activity through interaction with RanBPM and its associated CTLH complex. BMC Cancer. 2017;17:460 pubmed publisher
Han H, Du Y, Zhao W, Li S, Chen D, Zhang J, et al. PBX3 is targeted by multiple miRNAs and is essential for liver tumour-initiating cells. Nat Commun. 2015;6:8271 pubmed publisher
Pfirrmann T, Villavicencio Lorini P, Subudhi A, Menssen R, Wolf D, Hollemann T. RMND5 from Xenopus laevis is an E3 ubiquitin-ligase and functions in early embryonic forebrain development. PLoS ONE. 2015;10:e0120342 pubmed publisher

product information

master code :

NBP1-86683

SKU :

NBP1-86683

product name :

CACNA2D1 Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The CACNA2D1 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to CACNA2D1. This antibody reacts with human,mouse. The CACNA2D1 Antibody - BSA Free has been validated for the following applications: Immunohistochemistry-Frozen,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry,Immunohistochemistry-Paraffin.

target :

CACNA2D1

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

QPKNPKSQEPVTLDFLDAELENDIKVEIRNKMIDGESGE
KTFRTLVKSQDERYIDKGNRTYTWTPVNGTDYSLALVLP
TYSFYYIKAKLEETITQARSKKGKMKDSETLKPDNFEES
GYTFIAPRDYCNDLKISDNNTEFL
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human,Mouse

gene symbol :

CACNA2D1

Antibody validation :

Independent Anitbodies

applications :

Immunohistochemistry-Frozen,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry,Immunohistochemistry-Paraffin

USD :

559 USD

alt names :

CACNA2, CACNL2Adihydropyridine-sensitive L-type, calcium channel alpha-2/delta subunit, calcium channel, L type, alpha 2 polypeptide, calcium channel, voltage-dependent, alpha 2/delta subunit 1, CCHL2A, MHS3, voltage-dependent calcium channel subunit alpha-2/delta-1, Voltage-gated calcium channel subunit alpha-2/delta-1

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage