CBARA1 Antibody - BSA Free | Novus Biologicals NBP1-86663 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

CBARA1 Antibody - BSA Free

catalog :

NBP1-86663

quantity :

0.1 ml (also 25 ul)

price :

559 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

clone name :

8.00E+02

reactivity :

human, mouse

application :

western blot, immunohistochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 16

Reference
Di Marco G, Vallese F, Jourde B, Bergsdorf C, Sturlese M, De Mario A, et al. A High-Throughput Screening Identifies MICU1 Targeting Compounds. Cell Rep. 2020;30:2321-2331.e6 pubmed publisher
Ji L, Liu F, Jing Z, Huang Q, Zhao Y, Cao H, et al. MICU1 Alleviates Diabetic Cardiomyopathy Through Mitochondrial Ca2+-Dependent Antioxidant Response. Diabetes. 2017;66:1586-1600 pubmed publisher
Lee Y, Min C, Kim T, Song H, Lim Y, Kim D, et al. Structure and function of the N-terminal domain of the human mitochondrial calcium uniporter. EMBO Rep. 2015;16:1318-33 pubmed publisher
Wang W, Xie Q, Zhou X, Yao J, Zhu X, Huang P, et al. Mitofusin-2 triggers mitochondria Ca2+ influx from the endoplasmic reticulum to induce apoptosis in hepatocellular carcinoma cells. Cancer Lett. 2015;358:47-58 pubmed publisher
Lam S, Martell J, Kamer K, Deerinck T, Ellisman M, Mootha V, et al. Directed evolution of APEX2 for electron microscopy and proximity labeling. Nat Methods. 2015;12:51-4 pubmed publisher
Rosato A, Menin C, Boldrin D, Dalla Santa S, Bonaldi L, Scaini M, et al. Survivin expression impacts prognostically on NSCLC but not SCLC. Lung Cancer. 2013;79:180-6 pubmed publisher
Zeng S, Li Y, Jin Y, Zhang Q, Keller D, McQuaw C, et al. Structure-specific recognition protein 1 facilitates microtubule growth and bundling required for mitosis. Mol Cell Biol. 2010;30:935-47 pubmed publisher
Fortugno P, Beltrami E, Plescia J, Fontana J, Pradhan D, Marchisio P, et al. Regulation of survivin function by Hsp90. Proc Natl Acad Sci U S A. 2003;100:13791-6 pubmed
Carvalho A, Carmena M, Sambade C, Earnshaw W, Wheatley S. Survivin is required for stable checkpoint activation in taxol-treated HeLa cells. J Cell Sci. 2003;116:2987-98 pubmed
Fortugno P, Wall N, Giodini A, O Connor D, Plescia J, Padgett K, et al. Survivin exists in immunochemically distinct subcellular pools and is involved in spindle microtubule function. J Cell Sci. 2002;115:575-85 pubmed
Wheatley S, Carvalho A, Vagnarelli P, Earnshaw W. INCENP is required for proper targeting of Survivin to the centromeres and the anaphase spindle during mitosis. Curr Biol. 2001;11:886-90 pubmed
Kawasaki H, Toyoda M, Shinohara H, Okuda J, Watanabe I, Yamamoto T, et al. Expression of survivin correlates with apoptosis, proliferation, and angiogenesis during human colorectal tumorigenesis. Cancer. 2001;91:2026-32 pubmed
Granziero L, Ghia P, Circosta P, Gottardi D, Strola G, Geuna M, et al. Survivin is expressed on CD40 stimulation and interfaces proliferation and apoptosis in B-cell chronic lymphocytic leukemia. Blood. 2001;97:2777-83 pubmed
O Connor D, Grossman D, Plescia J, Li F, Zhang H, Villa A, et al. Regulation of apoptosis at cell division by p34cdc2 phosphorylation of survivin. Proc Natl Acad Sci U S A. 2000;97:13103-7 pubmed
Tanaka K, Iwamoto S, Gon G, Nohara T, Iwamoto M, Tanigawa N. Expression of survivin and its relationship to loss of apoptosis in breast carcinomas. Clin Cancer Res. 2000;6:127-34 pubmed
Grossman D, McNiff J, Li F, Altieri D. Expression and targeting of the apoptosis inhibitor, survivin, in human melanoma. J Invest Dermatol. 1999;113:1076-81 pubmed

product information

master code :

NBP1-86663

SKU :

NBP1-86663

product name :

CBARA1 Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The CBARA1 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to CBARA1. This antibody reacts with human,mouse. The CBARA1 Antibody - BSA Free has been validated for the following applications: Western Blot,Immunohistochemistry-Paraffin,Immunohistochemistry,Simple Western.

target :

CBARA1

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

LKGKLTIKNFLEFQRKLQHDVLKLEFERHDPVDGRITER
QFGGMLLAYSGVQSKKLTAMQRQLKKHFKEGKGLTFQEV
ENFFTFL
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human,Mouse

theoretical molecular weight :

54 kDa

gene symbol :

MICU1

accessionNumbers :

Q9BPX6

applications :

Western Blot,Immunohistochemistry-Paraffin,Immunohistochemistry,Simple Western

USD :

559 USD

alt names :

Allergen Hom s 4, ara CALC, Atopy-related autoantigen CALC, CALCDKFZp564C246, calcium binding atopy-related autoantigen 1, Calcium-binding atopy-related autoantigen 1, MICU1mitochondrial, mitochondrial calcium uptake 1

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage