product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
TRNT1 Antibody - BSA Free
catalog :
NBP1-86589
quantity :
0.1 ml (also 25 ul)
price :
559 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
clone name :
SPM427
reactivity :
human, rat
application :
western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section
more info or order :
citations: 6
| Reference |
|---|
product information
master code :
NBP1-86589
SKU :
NBP1-86589
product name :
TRNT1 Antibody - BSA Free
unit size :
0.1 ml (also 25 ul)
description :
The TRNT1 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to TRNT1. This antibody reacts with human,rat. The TRNT1 Antibody - BSA Free has been validated for the following applications: Western Blot,SDS-Page,Knockdown Validated,Simple Western,Immunohistochemistry,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence.
target :
TRNT1
category :
Primary Antibodies
buffer :
PBS (pH 7.2) and 40% Glycerol
clonality :
Polyclonal
conjugate :
Unconjugated
host :
Rabbit
immunogen :
LDLRLKIAKEEKNLGLFIVKNRKDLIKATDSSDPLKPYQ
DFIIDSREPDATTRVCELLKYQGEHCLLKEMQQWSIPPF
PVSGHDIR
This antibody was developed against Recombinant Protein corresponding to amino acids:
DFIIDSREPDATTRVCELLKYQGEHCLLKEMQQWSIPPF
PVSGHDIR
This antibody was developed against Recombinant Protein corresponding to amino acids:
isotype :
IgG
purity :
Immunogen affinity purified
species :
Human,Rat
theoretical molecular weight :
50 kDa
gene symbol :
TRNT1
Antibody validation :
Knockout/Knockdown
accessionNumbers :
Q96Q11
applications :
Western Blot,SDS-Page,Knockdown Validated,Simple Western,Immunohistochemistry,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence
USD :
559 USD
alt names :
CCA1, CCA-adding, CGI-47, EC 2.7.7.72, mitochondrial CCA-adding tRNA-nucleotidyltransferase, mt CCA-adding enzyme, mt tRNA adenylyltransferase, mt tRNA CCA-diphosphorylase, mt tRNA CCA-pyrophosphorylase, MtCCA, tRNA nucleotidyl transferase, CCA-adding, 1, tRNA-nucleotidyltransferase 1, mitochondrial
storage :
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
more info or order :
company information

Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
