BARHL1 Antibody - BSA Free | Novus Biologicals NBP1-86513 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

BARHL1 Antibody - BSA Free

catalog :

NBP1-86513

quantity :

0.1 ml (also 25 ul)

price :

569 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 8

Reference
Alekseenko Z, Dias J, Adler A, Kozhevnikova M, van Lunteren J, Nolbrant S, et al. Robust derivation of transplantable dopamine neurons from human pluripotent stem cells by timed retinoic acid delivery. Nat Commun. 2022;13:3046 pubmed publisher
Moriarty N, Kauhausen J, Pavan C, Hunt C, De Luzy I, Penna V, et al. Understanding the Influence of Target Acquisition on Survival, Integration, and Phenotypic Maturation of Dopamine Neurons within Stem Cell-Derived Neural Grafts in a Parkinson's Disease Model. J Neurosci. 2022;42:4995-5006 pubmed publisher
Zhang Y, Xu M, Shi X, Sun X, Mu W, Wu H, et al. Cascade diversification directs generation of neuronal diversity in the hypothalamus. Cell Stem Cell. 2021;28:1483-1499.e8 pubmed publisher
Gantner C, Cota Coronado A, Thompson L, Parish C. An Optimized Protocol for the Generation of Midbrain Dopamine Neurons under Defined Conditions. STAR Protoc. 2020;1:100065 pubmed publisher
Gantner C, De Luzy I, Kauhausen J, Moriarty N, Niclis J, Bye C, et al. Viral Delivery of GDNF Promotes Functional Integration of Human Stem Cell Grafts in Parkinson's Disease. Cell Stem Cell. 2020;26:511-526.e5 pubmed publisher
De Luzy I, Niclis J, Gantner C, Kauhausen J, Hunt C, Ermine C, et al. Isolation of LMX1a Ventral Midbrain Progenitors Improves the Safety and Predictability of Human Pluripotent Stem Cell-Derived Neural Transplants in Parkinsonian Disease. J Neurosci. 2019;39:9521-9531 pubmed publisher
Cardoso T, Adler A, Mattsson B, Hoban D, Nolbrant S, Wahlestedt J, et al. Target-specific forebrain projections and appropriate synaptic inputs of hESC-derived dopamine neurons grafted to the midbrain of parkinsonian rats. J Comp Neurol. 2018;526:2133-2146 pubmed publisher
Kee N, Volakakis N, Kirkeby A, Dahl L, Storvall H, Nolbrant S, et al. Single-Cell Analysis Reveals a Close Relationship between Differentiating Dopamine and Subthalamic Nucleus Neuronal Lineages. Cell Stem Cell. 2017;20:29-40 pubmed publisher

product information

master code :

NBP1-86513

SKU :

NBP1-86513

product name :

BARHL1 Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The BARHL1 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to BARHL1. This antibody reacts with human,mouse,rat. The BARHL1 Antibody - BSA Free has been validated for the following applications: IF/IHC,Protein Array,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry,Immunohistochemistry-Paraffin.

target :

BARHL1

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

LELSPRSESSSDCSSPASPGRDCLETGTPRPGGASGPGL
DSHLQPGQLSAPAQSRTVTSSFLIRDILADCKPLAACAP
YSSSGQPAAPEPGGRLAAKAAEDFRDKLDKSGSNASSDS
EYKVKEEGDREISSSRDSP
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human,Mouse,Rat

gene symbol :

BARHL1

applications :

IF/IHC,Protein Array,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry,Immunohistochemistry-Paraffin

USD :

569 USD

alt names :

BarH (Drosophila)-like 1, barH-like 1 homeobox protein, BarH-like homeobox 1

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage