MTF1 Antibody - BSA Free | Novus Biologicals NBP1-86380 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

MTF1 Antibody - BSA Free

catalog :

NBP1-86380

quantity :

0.1 ml (also 25 ul)

price :

569 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, bovine

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section, immunohistochemistry - frozen section

more info or order :

Novus Biologicals product webpage

citations: 11

Reference
Hacisuleyman E, Hale C, Noble N, Luo J, Fak J, Saito M, et al. Neuronal activity rapidly reprograms dendritic translation via eIF4G2:uORF binding. Nat Neurosci. 2024;27:822-835 pubmed publisher
Aksoy Ozer Z, Bitirim C, Turan B, Akcali K. The Role of Zinc on Liver Fibrosis by Modulating ZIP14 Expression Throughout Epigenetic Regulatory Mechanisms. Biol Trace Elem Res. 2024;202:5094-5105 pubmed publisher
Buchtova T, Beresova L, Chroma K, Pluháček T, Béres T, Kaczorova D, et al. Cannabis-derived products antagonize platinum drugs by altered cellular transport. Biomed Pharmacother. 2023;163:114801 pubmed publisher
Han H, Nakaoka H, Hofmann L, Zhou J, Yu C, Zeng L, et al. The Hippo pathway kinases LATS1 and LATS2 attenuate cellular responses to heavy metals through phosphorylating MTF1. Nat Cell Biol. 2022;24:74-87 pubmed publisher
Buchtova T, Skrott Z, Chroma K, Rehulka J, Dzubak P, Hajduch M, et al. Cannabidiol-induced activation of the metallothionein pathway impedes anticancer effects of disulfiram and its metabolite CuET. Mol Oncol. 2022;16:1541-1554 pubmed publisher
Xuan J, Zhu D, Cheng Z, Qiu Y, Shao M, Yang Y, et al. Crocin inhibits the activation of mouse hepatic stellate cells via the lnc-LFAR1/MTF-1/GDNF pathway. Cell Cycle. 2020;19:3480-3490 pubmed publisher
Zhang R, Zhao G, Shi H, Zhao X, Wang B, Dong P, et al. Zinc regulates primary ovarian tumor growth and metastasis through the epithelial to mesenchymal transition. Free Radic Biol Med. 2020;160:775-783 pubmed publisher
Schwarz M, Lossow K, Kopp J, Schwerdtle T, Kipp A. Crosstalk of Nrf2 with the Trace Elements Selenium, Iron, Zinc, and Copper. Nutrients. 2019;11: pubmed publisher
Fujie T, Takenaka F, Yoshida E, Yasuike S, Fujiwara Y, Shinkai Y, et al. Possible mechanisms underlying transcriptional induction of metallothionein isoforms by tris(pentafluorophenyl)stibane, tris(pentafluorophenyl)arsane, and tris(pentafluorophenyl)phosphane in cultured bovine aortic endothelial cells. J Toxicol Sci. 2019;44:327-333 pubmed publisher
Zhang D, Zhang T, Liu J, Chen J, Li Y, Ning G, et al. Zn Supplement-Antagonized Cadmium-Induced Cytotoxicity in Macrophages In Vitro: Involvement of Cadmium Bioaccumulation and Metallothioneins Regulation. J Agric Food Chem. 2019;67:4611-4622 pubmed publisher
Ji L, Zhao G, Zhang P, Huo W, Dong P, Watari H, et al. Knockout of MTF1 Inhibits the Epithelial to Mesenchymal Transition in Ovarian Cancer Cells. J Cancer. 2018;9:4578-4585 pubmed publisher

product information

master code :

NBP1-86380

SKU :

NBP1-86380

product name :

MTF1 Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The MTF1 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to MTF1. This antibody reacts with bovine,human,mouse. The MTF1 Antibody - BSA Free has been validated for the following applications: Western Blot,Immunohistochemistry-Paraffin,Immunohistochemistry-Frozen,Chemotaxis,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry.

target :

MTF1

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

EHSPDNNIIYFEAEEDELTPDDKMLRFVDKNGLVPSSSG
TVYDRTTVLIEQDPGTLEDEDDDGQCG
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Bovine,Human,Mouse

gene symbol :

MTF1

applications :

Western Blot,Chemotaxis,Immunohistochemistry-Paraffin,Immunohistochemistry-Frozen,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry

USD :

569 USD

alt names :

metal regulatory transcription factor 1, metal-regulatory transcription factor 1, metal-responsive transcription factor 1, MGC23036, MRE-binding transcription factor, MRE-binding transcription factor-1, MTF-1, Transcription factor MTF-1, zinc regulatory factor, ZRF

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage