This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
CAPS2 Antibody
catalog :
NBP1-85855
quantity :
0.1 ml (also 25 ul)
price :
499 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section
product information
brand :
Novus
master code :
NBP1-85855
SKU :
NBP1-85855
product name :
CAPS2 Antibody
unit size :
0.1 ml (also 25 ul)
seo description :
The CAPS2 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to CAPS2. This antibody reacts with human. The CAPS2 Antibody - BSA Free has been validated for the following applications: Immunohistochemistry,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence.
target :
CAPS2
category :
Primary Antibodies
buffer :
PBS (pH 7.2) and 40% Glycerol
clonality :
Polyclonal
conjugate :
Unconjugated
dilution :
Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000
host :
Rabbit
immunogen :
NDRLVFKAIQDVLKEKLHKRGVRILTGLGKYFQQLDKEG
NGLLDKADFKQALKVFHLEVSEKDFESAWLILNDNGNGK
VDYGEFKRGII
This antibody was developed against Recombinant Protein corresponding to amino acids:
isotype :
IgG
purity :
Immunogen affinity purified
species :
Human
gene symbol :
CAPS2
applications :
Immunohistochemistry,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence
USD :
499 USD
alt names :
calcyphosin-2, calcyphosine 2, Calcyphosine-2, calcyphosphine 2, FLJ34520
storage :
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
company information
Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com
3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.