SOX11 Antibody - BSA Free | Novus Biologicals NBP1-85823 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

SOX11 Antibody - BSA Free

catalog :

NBP1-85823

quantity :

0.1 ml (also 25 ul)

price :

559 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human

application :

western blot, immunohistochemistry, immunocytochemistry, chromatin immunoprecipitation, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 17

Reference
Shrestha A, Mehdizadeh Gohari I, McClane B. RIP1, RIP3, and MLKL Contribute to Cell Death Caused by Clostridium perfringens Enterotoxin. MBio. 2019;10: pubmed publisher
Zinngrebe J, Schlichtig F, Kraus J, Meyer M, Boldrin E, Kestler H, et al. Biomarker profile for prediction of response to SMAC mimetic monotherapy in pediatric precursor B-cell acute lymphoblastic leukemia. Int J Cancer. 2020;146:3219-3231 pubmed publisher
Goulielmaki M, Assimomytis N, Rožanc J, Taki E, Christodoulou I, Alexopoulos L, et al. DPS-2: A Novel Dual MEK/ERK and PI3K/AKT Pathway Inhibitor with Powerful Ex Vivo and In Vivo Anticancer Properties. Transl Oncol. 2019;12:932-950 pubmed publisher
Podder B, Guttà C, Rožanc J, Gerlach E, Feoktistova M, Panayotova Dimitrova D, et al. TAK1 suppresses RIPK1-dependent cell death and is associated with disease progression in melanoma. Cell Death Differ. 2019;: pubmed publisher
Yang L, Joseph S, Sun T, Hoffmann J, Thevissen S, Offermanns S, et al. TAK1 regulates endothelial cell necroptosis and tumor metastasis. Cell Death Differ. 2019;: pubmed publisher
Lafont E, Kantari Mimoun C, Dráber P, De Miguel D, Hartwig T, Reichert M, et al. The linear ubiquitin chain assembly complex regulates TRAIL-induced gene activation and cell death. EMBO J. 2017;36:1147-1166 pubmed publisher
Gutierrez K, Davis M, Daniels B, Olsen T, Ralli Jain P, Tait S, et al. MLKL Activation Triggers NLRP3-Mediated Processing and Release of IL-1β Independently of Gasdermin-D. J Immunol. 2017;198:2156-2164 pubmed publisher
Wang Y, Chang J, Liu X, Zhang X, Zhang S, Zhang X, et al. Discovery of piperlongumine as a potential novel lead for the development of senolytic agents. Aging (Albany NY). 2016;8:2915-2926 pubmed publisher
Aredia F, Czaplinski S, Fulda S, Scovassi A. Molecular features of the cytotoxicity of an NHE inhibitor: Evidence of mitochondrial alterations, ROS overproduction and DNA damage. BMC Cancer. 2016;16:851 pubmed
Righi S, Pileri S, Agostinelli C, Bacci F, Spagnolo S, Sabattini E. Reproducibility of SOX-11 detection in decalcified bone marrow tissue in mantle cell lymphoma patients. Hum Pathol. 2017;59:94-101 pubmed publisher
Dächert J, Schoeneberger H, Rohde K, Fulda S. RSL3 and Erastin differentially regulate redox signaling to promote Smac mimetic-induced cell death. Oncotarget. 2016;7:63779-63792 pubmed publisher
Perimenis P, Galaris A, Voulgari A, Prassa M, Pintzas A. IAP antagonists Birinapant and AT-406 efficiently synergise with either TRAIL, BRAF, or BCL-2 inhibitors to sensitise BRAFV600E colorectal tumour cells to apoptosis. BMC Cancer. 2016;16:624 pubmed publisher
de Almagro M, Goncharov T, Izrael Tomasevic A, Duttler S, Kist M, Varfolomeev E, et al. Coordinated ubiquitination and phosphorylation of RIP1 regulates necroptotic cell death. Cell Death Differ. 2017;24:26-37 pubmed publisher
Oliver Metzig M, Fuchs D, Tagscherer K, GrÃ¶ne H, Schirmacher P, Roth W. Inhibition of caspases primes colon cancer cells for 5-fluorouracil-induced TNF-Î±-dependent necroptosis driven by RIP1 kinase and NF-ÎºB. Oncogene. 2016;35:3399-409 pubmed publisher
Ribera Cortada I, Martinez D, Amador V, Royo C, Navarro A, BeÃ S, et al. Plasma cell and terminal B-cell differentiation in mantle cell lymphoma mainly occur in the SOX11-negative subtype. Mod Pathol. 2015;28:1435-47 pubmed publisher
Davidson B, Holth A, Hellesylt E, Tan T, Huang R, TropÃ© C, et al. The clinical role of epithelial-mesenchymal transition and stem cell markers in advanced-stage ovarian serous carcinoma effusions. Hum Pathol. 2015;46:1-8 pubmed publisher
Kuo P, Leshchenko V, Fazzari M, Perumal D, Gellen T, He T, et al. High-resolution chromatin immunoprecipitation (ChIP) sequencing reveals novel binding targets and prognostic role for SOX11 in mantle cell lymphoma. Oncogene. 2015;34:1231-40 pubmed publisher

product information

master code :

NBP1-85823

SKU :

NBP1-85823

product name :

SOX11 Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The SOX11 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to SOX11. This antibody reacts with human. The SOX11 Antibody - BSA Free has been validated for the following applications: Chemotaxis,IF/IHC,Western Blot,Immunohistochemistry,Immunohistochemistry-Paraffin,Chromatin Immunoprecipitation (ChIP).

target :

SOX11

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

FMVWSKIERRKIMEQSPDMHNAEISKRLGKRWKMLKDSE
KIPFIREAERLRLKHMADYPDYKYRPRKKPKMDPSAKPS
ASQSPEKSAAGGGGGSAGGGAGGAKTSKGSSKK
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human

gene symbol :

SOX11

applications :

Chemotaxis,IF/IHC,Western Blot,Immunohistochemistry,Immunohistochemistry-Paraffin,Chromatin Immunoprecipitation (ChIP)

USD :

559 USD

alt names :

SRY (sex determining region Y)-box 11, SRY (sex-determining region Y)-box 11, SRY-related HMG-box gene 11, transcription factor SOX-11

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage