product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
ATF3 Antibody - BSA Free
catalog :
NBP1-85816
quantity :
0.1 ml (also 25 ul)
price :
569 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section, immunohistochemistry - frozen section
more info or order :
citations: 43
Published Application/Species/Sample/DilutionReference
  • immunohistochemistry; mouse; 1:200; loading ...; fig 4c
Prokakis E, Dyas A, Grün R, Fritzsche S, Bedi U, Kazerouni Z, et al. USP22 promotes HER2-driven mammary carcinoma aggressiveness by suppressing the unfolded protein response. Oncogene. 2021;40:4004-4018 pubmed publisher
  • immunohistochemistry - frozen section; mouse; 1:500; loading ...; fig 1a
Holland S, Ramer L, McMahon S, Denk F, Ramer M. An ATF3-CreERT2 Knock-In Mouse for Axotomy-Induced Genetic Editing: Proof of Principle. Eneuro. 2019;6: pubmed publisher
Hu S, Cassim Bawa F, Zhu Y, Pan X, Wang H, Gopoju R, et al. Loss of adipose ATF3 promotes adipose tissue lipolysis and the development of MASH. Commun Biol. 2024;7:1300 pubmed publisher
Deininger S, Schumacher J, Blechschmidt A, Song J, Klugmann C, Antoniadis G, et al. Nerve injury converts Schwann cells in a long-term repair-like state in human neuroma tissue. Exp Neurol. 2024;382:114981 pubmed publisher
Pan J, Wang Z, Sun W, Pan P, Li W, Sun Y, et al. ATF3 is a neuron-specific biomarker for spinal cord injury and ischaemic stroke. Clin Transl Med. 2024;14:e1650 pubmed publisher
Miao Z, Sun J, Huang X, Bai S, Pang M, Li J, et al. Metaplastic regeneration in the mouse stomach requires a reactive oxygen species pathway. Dev Cell. 2024;59:1175-1191.e7 pubmed publisher
Asghari Adib E, Shadrach J, Reilly Jankowiak L, Dwivedi M, Rogers A, Shahzad S, et al. DLK signaling in axotomized neurons triggers complement activation and loss of upstream synapses. Cell Rep. 2024;43:113801 pubmed publisher
Kim H, Lee H, Jeon Y, Jang S, Shin Y, Yun J, et al. Targeting SARM1 improves autophagic stress-induced axonal neuropathy. Autophagy. 2024;20:29-44 pubmed publisher
Lou Y, Song F, Kang Y, Xu Y. Periodic Mechanical Stress Inhibits the Development of Osteoarthritis via Regulating ATF3-Akt Axis. J Inflamm Res. 2023;16:5613-5628 pubmed publisher
Dang I, Brazzo J, Bae Y, Assoian R. Key role for Rac in the early transcriptional response to extracellular matrix stiffness and stiffness-dependent repression of ATF3. J Cell Sci. 2023;136: pubmed publisher
Wang H, Cheng K, Tseng K, Kwan A, Chang L. AAV-glycine receptor α3 alleviates CFA-induced inflammatory pain by downregulating ERK phosphorylation and proinflammatory cytokine expression in SD rats. Mol Med. 2023;29:22 pubmed publisher
Feng R, Muraleedharan Saraswathy V, Mokalled M, Cavalli V. Self-renewing macrophages in dorsal root ganglia contribute to promote nerve regeneration. Proc Natl Acad Sci U S A. 2023;120:e2215906120 pubmed publisher
Yap T, Daver N, Mahendra M, Zhang J, Kamiya Matsuoka C, Meric Bernstam F, et al. Complex I inhibitor of oxidative phosphorylation in advanced solid tumors and acute myeloid leukemia: phase I trials. Nat Med. 2023;29:115-126 pubmed publisher
Cervia L, Shibue T, Borah A, Gaeta B, He L, Leung L, et al. A Ubiquitination Cascade Regulating the Integrated Stress Response and Survival in Carcinomas. Cancer Discov. 2023;13:766-795 pubmed publisher
James N, Woodman M, De La Cruz P, Eurich K, Ozsoy M, Schorl C, et al. Adaptive transcriptomic and immune infiltrate responses in the tumor immune microenvironment following neoadjuvant chemotherapy in high grade serous ovarian cancer reveal novel prognostic associations and activation of pro-tumorigenic pathways. Front Immunol. 2022;13:965331 pubmed publisher
Balogh M, Zhang J, Gaffney C, Kalakuntla N, Nguyen N, Trinh R, et al. Sensory neuron dysfunction in orthotopic mouse models of colon cancer. J Neuroinflammation. 2022;19:204 pubmed publisher
Serger E, Luengo Gutierrez L, Chadwick J, Kong G, Zhou L, Crawford G, et al. The gut metabolite indole-3 propionate promotes nerve regeneration and repair. Nature. 2022;607:585-592 pubmed publisher
Palazzo I, Todd L, Hoang T, Reh T, Blackshaw S, Fischer A. NFkB-signaling promotes glial reactivity and suppresses Müller glia-mediated neuron regeneration in the mammalian retina. Glia. 2022;70:1380-1401 pubmed publisher
Wang Y, Gao H, Wang F, Ye Z, Mokry M, Turner A, et al. Dynamic changes in chromatin accessibility are associated with the atherogenic transitioning of vascular smooth muscle cells. Cardiovasc Res. 2022;118:2792-2804 pubmed publisher
Zhu X, Xie W, Zhang J, Strong J, Zhang J. Sympathectomy decreases pain behaviors and nerve regeneration by downregulating monocyte chemokine CCL2 in dorsal root ganglia in the rat tibial nerve crush model. Pain. 2022;163:e106-e120 pubmed publisher
Quiroz Figueroa K, Vitali C, Conlon D, Millar J, Tobias J, Bauer R, et al. TRIB1 regulates LDL metabolism through CEBPα-mediated effects on the LDL receptor in hepatocytes. J Clin Invest. 2021;131: pubmed publisher
Chen Z, Zhang J, Wei D, Chen J, Yang J. GCN2 Regulates ATF3-p38 MAPK Signaling Transduction in Pulmonary Veno-Occlusive Disease. J Cardiovasc Pharmacol Ther. 2021;26:677-689 pubmed publisher
Lindborg J, Tran N, Chenette D, DeLuca K, Foli Y, Kannan R, et al. Optic nerve regeneration screen identifies multiple genes restricting adult neural repair. Cell Rep. 2021;34:108777 pubmed publisher
Xu Y, Li Y, Jadhav K, Pan X, Zhu Y, Hu S, et al. Hepatocyte ATF3 protects against atherosclerosis by regulating HDL and bile acid metabolism. Nat Metab. 2021;3:59-74 pubmed publisher
Ewan E, Avraham O, Carlin D, Gonçalves T, Zhao G, Cavalli V. Ascending dorsal column sensory neurons respond to spinal cord injury and downregulate genes related to lipid metabolism. Sci Rep. 2021;11:374 pubmed publisher
Kampanis V, Tolou Dabbaghian B, Zhou L, Roth W, Puttagunta R. Cyclic Stretch of Either PNS or CNS Located Nerves Can Stimulate Neurite Outgrowth. Cells. 2020;10: pubmed publisher
Hong L, Li F, Tang C, Li L, Sun L, Li X, et al. Semaphorin 7A promotes endothelial to mesenchymal transition through ATF3 mediated TGF-β2/Smad signaling. Cell Death Dis. 2020;11:695 pubmed publisher
Nguyen T, Zhang Y, Shang E, Shu C, Quinzii C, Westhoff M, et al. Inhibition of HDAC1/2 Along with TRAP1 Causes Synthetic Lethality in Glioblastoma Model Systems. Cells. 2020;9: pubmed publisher
Leng S, Pignatti E, Khetani R, Shah M, Xu S, Miao J, et al. β-Catenin and FGFR2 regulate postnatal rosette-based adrenocortical morphogenesis. Nat Commun. 2020;11:1680 pubmed publisher
Li W, Zhan M, Quan Y, Wang H, Hua S, Li Y, et al. Modulating the tumor immune microenvironment with sunitinib malate supports the rationale for combined treatment with immunotherapy. Int Immunopharmacol. 2020;81:106227 pubmed publisher
Willemse J, Verstegen M, Vermeulen A, Schurink I, Roest H, van der Laan L, et al. Fast, robust and effective decellularization of whole human livers using mild detergents and pressure controlled perfusion. Mater Sci Eng C Mater Biol Appl. 2020;108:110200 pubmed publisher
Vysokov N, McMahon S, Raouf R. The role of NaV channels in synaptic transmission after axotomy in a microfluidic culture platform. Sci Rep. 2019;9:12915 pubmed publisher
Mehta N, Gava A, Zhang D, Gao B, Krepinsky J. Follistatin Protects against Glomerular Mesangial Cell Apoptosis and Oxidative Stress to Ameliorate Chronic Kidney Disease. Antioxid Redox Signal. 2019;: pubmed publisher
MacDonald J, Takai Y, Ishihara O, Seki H, Woods D, Tilly J. Extracellular matrix signaling activates differentiation of adult ovary-derived oogonial stem cells in a species-specific manner. Fertil Steril. 2019;111:794-805 pubmed publisher
Bianchetti E, Bates S, Carroll S, Siegelin M, Roth K. Usp9X Regulates Cell Death in Malignant Peripheral Nerve Sheath Tumors. Sci Rep. 2018;8:17390 pubmed publisher
Mousseau M, Burma N, Lee K, Leduc Pessah H, Kwok C, Reid A, et al. Microglial pannexin-1 channel activation is a spinal determinant of joint pain. Sci Adv. 2018;4:eaas9846 pubmed publisher
Trasino S, Tang X, Shevchuk M, Choi M, Gudas L. Amelioration of Diabetic Nephropathy Using a Retinoic Acid Receptor ?2 Agonist. J Pharmacol Exp Ther. 2018;367:82-94 pubmed publisher
Rüger B, Buchacher T, Giurea A, Kubista B, Fischer M, Breuss J. Vascular Morphogenesis in the Context of Inflammation: Self-Organization in a Fibrin-Based 3D Culture System. Front Physiol. 2018;9:679 pubmed publisher
Nikolaou S, Hadjikypri X, Ioannou G, Elia A, Georgiades P. Functional and phenotypic distinction of the first two trophoblast subdivisions and identification of the border between them during early postimplantation: A prerequisite for understanding early patterning during placentogenesis. Biochem Biophys Res Commun. 2018;496:64-69 pubmed publisher
Velez D, Tsui B, Goshia T, Chute C, Han A, Carter H, et al. 3D collagen architecture induces a conserved migratory and transcriptional response linked to vasculogenic mimicry. Nat Commun. 2017;8:1651 pubmed publisher
Lin E, Bayarsengee U, Wang C, Chiang Y, Cheng C. The natural compound 2,3,5,4'-tetrahydroxystilbene-2-O-β-d glucoside protects against adriamycin-induced nephropathy through activating the Nrf2-Keap1 antioxidant pathway. Environ Toxicol. 2018;33:72-82 pubmed publisher
Bracaglia L, Messina M, Winston S, Kuo C, Lerman M, Fisher J. 3D Printed Pericardium Hydrogels To Promote Wound Healing in Vascular Applications. Biomacromolecules. 2017;18:3802-3811 pubmed publisher
Liguori R, Incensi A, De Pasqua S, Mignani R, Fileccia E, Santostefano M, et al. Skin globotriaosylceramide 3 deposits are specific to Fabry disease with classical mutations and associated with small fibre neuropathy. PLoS ONE. 2017;12:e0180581 pubmed publisher
product information
master code :
NBP1-85816
SKU :
NBP1-85816
product name :
ATF3 Antibody - BSA Free
unit size :
0.1 ml (also 25 ul)
description :
The ATF3 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to ATF3. This antibody reacts with feline,human,mouse,rat. The ATF3 Antibody - BSA Free has been validated for the following applications: Immunohistochemistry,Chemotaxis,IF/IHC,Western Blot,Immunohistochemistry-Paraffin,Immunohistochemistry-Frozen,Immunocytochemistry/ Immunofluorescence,Knockout Validated.
target :
ATF3
category :
Primary Antibodies
buffer :
PBS (pH 7.2) and 40% Glycerol
clonality :
Polyclonal
conjugate :
Unconjugated
host :
Rabbit
immunogen :
MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTP
FVKEELRFAIQNKHLCHRMSSALESVTVSDRPLGVSITK
AEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTEC
This antibody was developed against Recombinant Protein corresponding to amino acids:
isotype :
IgG
purity :
Immunogen affinity purified
species :
Feline,Human,Mouse,Rat
gene symbol :
ATF3
Antibody validation :
Biological Validation
applications :
Immunohistochemistry,Chemotaxis,IF/IHC,Western Blot,Immunohistochemistry-Paraffin,Immunohistochemistry-Frozen,Immunocytochemistry/ Immunofluorescence,Knockout Validated
USD :
569 USD
alt names :
activating transcription factor 3cAMP-dependent transcription factor ATF-3, ATF3deltaZip2, ATF3deltaZip2c, ATF3deltaZip3, cyclic AMP-dependent transcription factor ATF-3
storage :
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
more info or order :
company information
Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com
3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.