Integrin alpha 6/CD49f Antibody - BSA Free | Novus Biologicals NBP1-85747 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

Integrin alpha 6/CD49f Antibody - BSA Free

catalog :

NBP1-85747

quantity :

0.1 ml (also 25 ul)

price :

559 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

clone name :

1284B

reactivity :

human, mouse

application :

western blot, immunohistochemistry, immunocytochemistry, immunoprecipitation, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 7

Reference
Chalmers F, Dusold J, Shaik J, Walsh H, Glick A. Targeted deletion of TGFβ1 in basal keratinocytes causes profound defects in stratified squamous epithelia and aberrant melanocyte migration. Dev Biol. 2022;485:9-23 pubmed publisher
You Y, Muraoka S, Jedrychowski M, Hu J, McQuade A, Young Pearse T, et al. Human neural cell type-specific extracellular vesicle proteome defines disease-related molecules associated with activated astrocytes in Alzheimer's disease brain. J Extracell Vesicles. 2022;11:e12183 pubmed publisher
Gordillo G, Biswas A, Singh K, Sen A, Guda P, Miller C, et al. Mitochondria as Target for Tumor Management of Hemangioendothelioma. Antioxid Redox Signal. 2020;: pubmed publisher
Barbar L, Jain T, Zimmer M, Kruglikov I, Sadick J, Wang M, et al. CD49f Is a Novel Marker of Functional and Reactive Human iPSC-Derived Astrocytes. Neuron. 2020;107:436-453.e12 pubmed publisher
Ruegsegger G, Manjunatha S, Summer P, Gopala S, Zabeilski P, Dasari S, et al. Insulin deficiency and intranasal insulin alter brain mitochondrial function: a potential factor for dementia in diabetes. FASEB J. 2019;33:4458-4472 pubmed publisher
Nobis S, Goichon A, Achamrah N, GuÃ©rin C, Azhar S, Chan P, et al. Alterations of proteome, mitochondrial dynamic and autophagy in the hypothalamus during activity-based anorexia. Sci Rep. 2018;8:7233 pubmed publisher
Hooks K, Audoux J, Fazli H, Lesjean S, Ernault T, Senant N, et al. New insights into diagnosis and therapeutic options for proliferative hepatoblastoma. Hepatology. 2017;: pubmed publisher

product information

master code :

NBP1-85747

SKU :

NBP1-85747

product name :

Integrin alpha 6/CD49f Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The Integrin alpha 6/CD49f Antibody - BSA Free from Novus is a rabbit polyclonal antibody to Integrin alpha 6/CD49f. This antibody reacts with human,mouse. The Integrin alpha 6/CD49f Antibody - BSA Free has been validated for the following applications: IF/IHC,Immunoprecipitation,Western Blot,Immunohistochemistry-Paraffin,Immunohistochemistry,Simple Western.

target :

Integrin alpha 6/CD49f

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

APYDDLGKVFIYHGSANGINTKPTQVLKGISPYFGYSIA
GNMDLDRNSYPDVAVGSLSDSVTIFRSRPVINIQKTITV
TPNRIDLRQKTACGAPSGICLQVKSCFEYTANPAGYNPS
ISIVGTLEAEKERRKSGLSS
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human,Mouse

theoretical molecular weight :

127 kDa

gene symbol :

ITGA6

Antibody validation :

Orthogonal Validation

accessionNumbers :

P23229

applications :

IF/IHC,Immunoprecipitation,Western Blot,Immunohistochemistry-Paraffin,Immunohistochemistry,Simple Western

USD :

559 USD

alt names :

CD49 antigen-like family member F, CD49f, CD49f antigen, DKFZp686J01244, FLJ18737, integrin alpha-6, integrin alpha6B, integrin, alpha 6, ITGA6B, VLA-6

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage