5'-Nucleotidase/CD73 Antibody - BSA Free | Novus Biologicals NBP1-85740 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

5'-Nucleotidase/CD73 Antibody - BSA Free

catalog :

NBP1-85740

quantity :

0.1 ml (also 25 ul)

price :

559 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, rhesus macaque

application :

western blot, ELISA, immunohistochemistry, immunocytochemistry, flow cytometry, immunohistochemistry - paraffin section, immunohistochemistry - frozen section

more info or order :

Novus Biologicals product webpage

citations: 20

Published Application/Species/Sample/Dilution	Reference
western blot; human; fig 2	Thibaudin M, Chaix M, Boidot R, VÃ©gran F, DerangÃ¨re V, Limagne E, et al. Human ectonucleotidase-expressing CD25high Th17 cells accumulate in breast cancer tumors and exert immunosuppressive functions. Oncoimmunology. 2016;5:e1055444 pubmed
	Ahmed M, Farag A, Boys I, Wang P, Menendez Montes I, Nguyen N, et al. FDA approved drugs with antiviral activity against SARS-CoV-2: From structure-based repurposing to host-specific mechanisms. Biomed Pharmacother. 2023;162:114614 pubmed publisher
	Mongui xf3 Tortajada M, Prat Vidal C, Mart xed nez Falguera D, Teis A, Soler Botija C, Courageux Y, et al. Acellular cardiac scaffolds enriched with MSC-derived extracellular vesicles limit ventricular remodelling and exert local and systemic immunomodulation in a myocardial infarction porcine model. Theranostics. 2022;12:4656-4670 pubmed publisher
	Pang L, Ng K, Liu J, Yeung W, Zhu J, Chiu T, et al. Plasmacytoid dendritic cells recruited by HIF-1α/eADO/ADORA1 signaling induce immunosuppression in hepatocellular carcinoma. Cancer Lett. 2021;522:80-92 pubmed publisher
	Muñóz Godínez R, de Lourdes Mora García M, Weiss Steider B, Montesinos Montesinos J, Del Carmen Aguilar Lemarroy A, García Rocha R, et al. Detection of CD39 and a Highly Glycosylated Isoform of Soluble CD73 in the Plasma of Patients with Cervical Cancer: Correlation with Disease Progression. Mediators Inflamm. 2020;2020:1678780 pubmed publisher
	Chen T, Lin R, Avula L, Sarker R, Yang J, Cha B, et al. NHERF3 is necessary for Escherichia coli heat-stable enterotoxin-induced inhibition of NHE3: differences in signaling in mouse small intestine and Caco-2 cells. Am J Physiol Cell Physiol. 2019;317:C737-C748 pubmed publisher
	de Lourdes Mora García M, López Cisneros S, Gutiérrez Serrano V, García Rocha R, Weiss Steider B, Hernández Montes J, et al. HPV-16 Infection Is Associated with a High Content of CD39 and CD73 Ectonucleotidases in Cervical Samples from Patients with CIN-1. Mediators Inflamm. 2019;2019:4651627 pubmed publisher
	Pinette J, Mao S, Millis B, Krystofiak E, Faust J, Tyska M. Brush border protocadherin CDHR2 promotes the elongation and maximized packing of microvilli in vivo. Mol Biol Cell. 2019;30:108-118 pubmed publisher
	Engevik A, Kaji I, Engevik M, Meyer A, Weis V, Goldstein A, et al. Loss of MYO5B Leads to Reductions in Na+ Absorption With Maintenance of CFTR-Dependent Cl- Secretion in Enterocytes. Gastroenterology. 2018;155:1883-1897.e10 pubmed publisher
	Schlegel C, Lapierre L, Weis V, Williams J, Kaji I, Pinzon Guzman C, et al. Reversible deficits in apical transporter trafficking associated with deficiency in diacylglycerol acyltransferase. Traffic. 2018;19:879-892 pubmed publisher
	Singh V, Yang J, Yin J, Cole R, Tse M, Berman D, et al. Cholera toxin inhibits SNX27-retromer-mediated delivery of cargo proteins to the plasma membrane. J Cell Sci. 2018;131: pubmed publisher
	Yin J, Tse C, Avula L, Singh V, Foulke Abel J, de Jonge H, et al. Molecular Basis and Differentiation-Associated Alterations of Anion Secretion in Human Duodenal Enteroid Monolayers. Cell Mol Gastroenterol Hepatol. 2018;5:591-609 pubmed publisher
	Samanta D, Park Y, Ni X, Li H, Zahnow C, Gabrielson E, et al. Chemotherapy induces enrichment of CD47+/CD73+/PDL1+ immune evasive triple-negative breast cancer cells. Proc Natl Acad Sci U S A. 2018;115:E1239-E1248 pubmed publisher
	Rajkumar P, Cha B, Yin J, Arend L, Paunescu T, Hirabayashi Y, et al. Identifying the localization and exploring a functional role for Gprc5c in the kidney. FASEB J. 2018;32:2046-2059 pubmed publisher
	Calabrese G, Giuffrida R, Forte S, Fabbi C, Figallo E, Salvatorelli L, et al. Human adipose-derived mesenchymal stem cells seeded into a collagen-hydroxyapatite scaffold promote bone augmentation after implantation in the mouse. Sci Rep. 2017;7:7110 pubmed publisher
	Bullen J, Tchernyshyov I, Holewinski R, Devine L, Wu F, Venkatraman V, et al. Protein kinase A-dependent phosphorylation stimulates the transcriptional activity of hypoxia-inducible factor 1. Sci Signal. 2016;9:ra56 pubmed publisher
	Foulke Abel J, In J, Yin J, Zachos N, Kovbasnjuk O, Estes M, et al. Human Enteroids as a Model of Upper Small Intestinal Ion Transport Physiology and Pathophysiology. Gastroenterology. 2016;150:638-649.e8 pubmed publisher
	D Alimonte I, Nargi E, Zuccarini M, Lanuti P, Di Iorio P, Giuliani P, et al. Potentiation of temozolomide antitumor effect by purine receptor ligands able to restrain the in vitro growth of human glioblastoma stem cells. Purinergic Signal. 2015;11:331-46 pubmed publisher
	Engevik M, Engevik K, Yacyshyn M, Wang J, Hassett D, Darien B, et al. Human Clostridium difficile infection: inhibition of NHE3 and microbiota profile. Am J Physiol Gastrointest Liver Physiol. 2015;308:G497-509 pubmed publisher
	Alberton P, Dex S, Popov C, Shukunami C, Schieker M, Docheva D. Loss of tenomodulin results in reduced self-renewal and augmented senescence of tendon stem/progenitor cells. Stem Cells Dev. 2015;24:597-609 pubmed publisher

product information

master code :

NBP1-85740

SKU :

NBP1-85740

product name :

5'-Nucleotidase/CD73 Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The 5'-Nucleotidase/CD73 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to 5'-Nucleotidase/CD73. This antibody reacts with human,porcine,primate - macaca mulatta (rhesus macaque). The 5'-Nucleotidase/CD73 Antibody - BSA Free has been validated for the following applications: Western Blot,IF/IHC,ELISA,Flow Cytometry,Immunohistochemistry-Frozen,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry,Immunohistochemistry-Paraffin.

target :

5'-Nucleotidase/CD73

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

EFDNGVEGLIEPLLKEAKFPILSANIKAKGPLASQISGL
YLPYKVLPVGDEVVGIVGYTSKETPFLSNPGTNLVFEDE
ITALQPEVDKLKTLNVNKIIALGHSGFEMDKLIAQK
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human,Porcine,Primate - Macaca mulatta (Rhesus Macaque)

gene symbol :

NT5E

accessionNumbers :

P21589

applications :

Western Blot,IF/IHC,ELISA,Flow Cytometry,Immunohistochemistry-Frozen,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry,Immunohistochemistry-Paraffin

USD :

559 USD

alt names :

5' nucleotidase (CD73), 5'-NT, 5'-nucleotidase, ecto (CD73), CD73, CD73 antigen, E5NT, EC 3.1.3.5, ecto-5'-nucleotidase, eN, eNT, NT, NT55'-nucleotidase, NTE, Purine 5-Prime-Nucleotidase

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage