CPSF6 Antibody - BSA Free | Novus Biologicals NBP1-85676 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

CPSF6 Antibody - BSA Free

catalog :

NBP1-85676

quantity :

0.1 ml (also 25 ul)

price :

569 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 5

Reference
Liu S, Wu R, Chen L, Deng K, Ou X, Lu X, et al. CPSF6 regulates alternative polyadenylation and proliferation of cancer cells through phase separation. Cell Rep. 2023;42:113197 pubmed publisher
Scoca V, Morin R, Collard M, Tinevez J, Di Nunzio F. HIV-induced membraneless organelles orchestrate post-nuclear entry steps. J Mol Cell Biol. 2022;: pubmed publisher
Hu Z, Li M, Huo Z, Chen L, Liu S, Deng K, et al. U1 snRNP proteins promote proximal alternative polyadenylation sites by directly interacting with 3' end processing core factors. J Mol Cell Biol. 2022;14: pubmed publisher
Zhong Z, Ning J, Boggs E, Jang S, Wallace C, TELMER C, et al. Cytoplasmic CPSF6 Regulates HIV-1 Capsid Trafficking and Infection in a Cyclophilin A-Dependent Manner. MBio. 2021;12: pubmed publisher
Ren Z, Lin C, Cao W, Yang R, Lu W, Liu Z, et al. CD73 is associated with poor prognosis in HNSCC. Oncotarget. 2016;7:61690-61702 pubmed publisher

product information

master code :

NBP1-85676

SKU :

NBP1-85676

product name :

CPSF6 Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The CPSF6 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to CPSF6. This antibody reacts with human,mouse,rat. The CPSF6 Antibody - BSA Free has been validated for the following applications: Western Blot,Immunocytochemistry/ Immunofluorescence,IF/IHC,Knockdown Validated,Immunohistochemistry,Immunohistochemistry-Paraffin.

target :

CPSF6

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

ISPSANNGDAPEDRDYMDTLPPTVGDDVGKGAAPNVVYT
YTGKRIALYIGNLTWWTTDEDLTEAVHSLGVN
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human,Mouse,Rat

gene symbol :

CPSF6

Antibody validation :

Knockout/Knockdown

applications :

Western Blot,Immunocytochemistry/ Immunofluorescence,IF/IHC,Knockdown Validated,Immunohistochemistry,Immunohistochemistry-Paraffin

USD :

569 USD

alt names :

CFIM, CFIm68, CFIM68CPSF 68 kDa subunit, CFIMcleavage and polyadenylation specific factor 6, 68kD subunit, cleavage and polyadenylation specific factor 6, 68kDa, Cleavage and polyadenylation specificity factor 68 kDa subunit, cleavage and polyadenylation specificity factor subunit 6, HPBRII-4, HPBRII-7, pre-mRNA cleavage factor I, 68kD subunit, pre-mRNA cleavage factor Im (68kD), Pre-mRNA cleavage factor Im 68 kDa subunit, Protein HPBRII-4/7

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage