product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
Chorein Antibody - BSA Free
catalog :
NBP1-85641
quantity :
0.1 ml (also 25 ul)
price :
579 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
clone name :
ACK2
reactivity :
human, mouse
application :
western blot, immunohistochemistry, immunocytochemistry, immunoprecipitation, immunohistochemistry - paraffin section
more info or order :
citations: 15
Reference
Amos C, Xu P, De Camilli P. Erythroid Differentiation Dependent Interaction of VPS13A with XK at the Plasma Membrane of K562 Cells. Contact (Thousand Oaks). 2023;6:25152564231215133 pubmed publisher
Nguyen T, Voeltz G. An ER phospholipid hydrolase drives ER-associated mitochondrial constriction for fission and fusion. elife. 2022;11: pubmed publisher
Guill xe9 n Samander A, Wu Y, Pineda S, Garc xed a F, Eisen J, Leonzino M, et al. A partnership between the lipid scramblase XK and the lipid transfer protein VPS13A at the plasma membrane. Proc Natl Acad Sci U S A. 2022;119:e2205425119 pubmed publisher
Shahi I, Llaneras C, Perelman S, Torres V, Ratner A. Genome-Wide CRISPR-Cas9 Screen Does Not Identify Host Factors Modulating Streptococcus agalactiae β-Hemolysin/Cytolysin-Induced Cell Death. Microbiol Spectr. 2022;10:e0218621 pubmed publisher
Ryoden Y, Segawa K, Nagata S. Requirement of Xk and Vps13a for the P2X7-mediated phospholipid scrambling and cell lysis in mouse T cells. Proc Natl Acad Sci U S A. 2022;119: pubmed publisher
Tada Y, Hamaguchi T, Ikeda Y, Iwasa K, Nishida Y, Nakamura M, et al. Chorea-acanthocytosis with a novel mutation in the vacuolar protein sorting 13 homolog a gene: A case report. J Neurol Sci. 2020;412:116731 pubmed publisher
. Novel pathogenic VPS13A gene mutations in Japanese patients with chorea-acanthocytosis. Neurol Genet. 2019;5:e332 pubmed publisher
Kumar N, Leonzino M, Hancock Cerutti W, Horenkamp F, Li P, Lees J, et al. VPS13A and VPS13C are lipid transport proteins differentially localized at ER contact sites. J Cell Biol. 2018;217:3625-3639 pubmed publisher
Nagata O, Nakamura M, Sakimoto H, Urata Y, Sasaki N, Shiokawa N, et al. Mouse model of chorea-acanthocytosis exhibits male infertility caused by impaired sperm motility as a result of ultrastructural morphological abnormalities in the mitochondrial sheath in the sperm midpiece. Biochem Biophys Res Commun. 2018;503:915-920 pubmed publisher
Gude N, Firouzi F, Broughton K, Ilves K, Nguyen K, Payne C, et al. Cardiac c-Kit Biology Revealed by Inducible Transgenesis. Circ Res. 2018;123:57-72 pubmed publisher
Sasaki N, Nakamura M, Kodama A, Urata Y, Shiokawa N, Hayashi T, et al. Chorein interacts with ?-tubulin and histone deacetylase 6, and overexpression preserves cell viability during nutrient deprivation in human embryonic kidney 293 cells. FASEB J. 2016;30:3726-3732 pubmed
Schwerdtfeger L, Ryan E, Tobet S. An organotypic slice model for ex vivo study of neural, immune, and microbial interactions of mouse intestine. Am J Physiol Gastrointest Liver Physiol. 2016;310:G240-8 pubmed publisher
Zhang L, Tang J, Haines C, Feng H, Lai L, Teng X, et al. c-kit expression profile and regulatory factors during spermatogonial stem cell differentiation. BMC Dev Biol. 2013;13:38 pubmed publisher
Meyer S, Maufort J, Nie J, Stewart R, McIntosh B, Conti L, et al. Development of an efficient targeted cell-SELEX procedure for DNA aptamer reagents. PLoS ONE. 2013;8:e71798 pubmed publisher
Fu W, Song B, Li W, Shen W, Ji H, Wang Y, et al. Ultrastructural features and possible functional role of kit-positive interstitial cells in the guinea pig corpus cavernosum. Int J Impot Res. 2011;23:173-9 pubmed publisher
product information
brand :
Novus
catalog number base :
NBP1-85641
SKU :
NBP1-85641
product name :
Chorein Antibody - BSA Free
units size :
0.1 ml (also 25 ul)
description :
The Chorein Antibody - BSA Free from Novus is a rabbit polyclonal antibody to Chorein. This antibody reacts with human,mouse. The Chorein Antibody - BSA Free has been validated for the following applications: Immunohistochemistry,Immunoprecipitation,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence.
target :
Chorein
category :
Primary Antibodies
buffer :
PBS (pH 7.2) and 40% Glycerol
clonality :
Polyclonal
conjugate :
Unconjugated
all_available conjugate :
Unconjugated
host :
Rabbit
immunogen :
RPPRFFNEDGVIRPYRLRDGTGNQMLQVMENGRFAKYKY
FTHVMINKTDMLMITRRGVLFVTKGTFGQLTCEWQYSFD
EFTKEPFIVHGRRLRIEAKERVKSVF
This antibody was developed against Recombinant Protein corresponding to amino acids:
isotype :
IgG
purity :
Immunogen affinity purified
species :
Human,Mouse
gene symbol :
VPS13A
top caption :
Immunohistochemistry-Paraffin: Chorein Antibody [NBP1-85641]
applications :
Immunohistochemistry,Immunoprecipitation,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence
USD :
579 USD
alt names :
CHAC, chorea-acanthocytosis protein, vacuolar protein sorting 13 homolog A (S. cerevisiae), vacuolar protein sorting 13A
storage :
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
more info or order :
company information
Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com
3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.