Ubiquilin 2 Antibody - BSA Free | Novus Biologicals NBP1-85639 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

Ubiquilin 2 Antibody - BSA Free

catalog :

NBP1-85639

quantity :

0.1 ml (also 25 ul)

price :

549 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 6

Reference
Idera A, Sharkey L, Kurauchi Y, Kadoyama K, Paulson H, Katsuki H, et al. Wild-type and pathogenic forms of ubiquilin 2 differentially modulate components of the autophagy-lysosome pathways. J Pharmacol Sci. 2023;152:182-192 pubmed publisher
Sharkey L, Sandoval Pistorius S, Moore S, Gerson J, Komlo R, Fischer S, et al. Modeling UBQLN2-mediated neurodegenerative disease in mice: Shared and divergent properties of wild type and mutant UBQLN2 in phase separation, subcellular localization, altered proteostasis pathways, and selective cytotoxicity. Neurobiol Dis. 2020;143:105016 pubmed publisher
Sharkey L, Safren N, Pithadia A, Gerson J, Dulchavsky M, Fischer S, et al. Mutant UBQLN2 promotes toxicity by modulating intrinsic self-assembly. Proc Natl Acad Sci U S A. 2018;115:E10495-E10504 pubmed publisher
Yau R, Doerner K, Castellanos E, Haakonsen D, Werner A, Wang N, et al. Assembly and Function of Heterotypic Ubiquitin Chains in Cell-Cycle and Protein Quality Control. Cell. 2017;171:918-933.e20 pubmed publisher
Ceballos Diaz C, Rosario A, Park H, Chakrabarty P, Sacino A, Cruz P, et al. Viral expression of ALS-linked ubiquilin-2 mutants causes inclusion pathology and behavioral deficits in mice. Mol Neurodegener. 2015;10:25 pubmed publisher
Zeng L, Wang B, Merillat S, Minakawa E, Perkins M, Ramani B, et al. Differential recruitment of UBQLN2 to nuclear inclusions in the polyglutamine diseases HD and SCA3. Neurobiol Dis. 2015;82:281-288 pubmed publisher

product information

master code :

NBP1-85639

SKU :

NBP1-85639

product name :

Ubiquilin 2 Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The Ubiquilin 2 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to Ubiquilin 2. This antibody reacts with human,mouse. The Ubiquilin 2 Antibody - BSA Free has been validated for the following applications: IF/IHC,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry,Simple Western,Knockdown Validated.

target :

Ubiquilin 2

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

LSAMSNPRAMQALMQIQQGLQTLATEAPGLIPSFTPGVG
VGVLGTAIGPVGPVTPIGPIGPIVPFTPIGPIGPIGPTG
PAAPPGSTGSGGPTGPTVSSAAPSETTSPTSESGPNQQF
IQQMVQALAGANAPQLPNPEVRFQQQLEQLN
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human,Mouse

gene symbol :

UBQLN2

applications :

IF/IHC,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry,Simple Western,Knockdown Validated

USD :

549 USD

alt names :

Chap1, CHAP1/DSK2, DSK2, DSK2 homolog, FLJ10167, FLJ56541, hPLIC-2, N4BP4LIC-2, Nedd4 binding protein 4, PLIC-2, PLIC2Dsk2, Protein linking IAP with cytoskeleton 2, RIHFB2157, ubiquilin 2, ubiquilin-2, Ubiquitin-like product Chap1/Dsk2

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage