product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
SOX9 Antibody - BSA Free
catalog :
NBP1-85551
quantity :
0.1 ml
price :
579 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
clone name :
38C674.2
reactivity :
human, mouse, rat, dogs
application :
western blot, immunohistochemistry, immunocytochemistry, EMSA, immunohistochemistry - paraffin section, immunohistochemistry - frozen section
more info or order :
citations: 56
Published Application/Species/Sample/DilutionReference
  • immunohistochemistry; mouse; loading ...; fig 3d
Ranea Robles P, Portman K, Bender A, Lee K, He J, Mulholland D, et al. Peroxisomal L-bifunctional protein (EHHADH) deficiency causes male-specific kidney hypertrophy and proximal tubular injury in mice. Kidney360. 2021;2:1441-1454 pubmed publisher
  • immunohistochemistry - frozen section; mouse; 1:100; loading ...; fig 3s3b
Kaczmarek Hájek K, Zhang J, Kopp R, Grosche A, Rissiek B, Saul A, et al. Re-evaluation of neuronal P2X7 expression using novel mouse models and a P2X7-specific nanobody. elife. 2018;7: pubmed publisher
Yano Sakamoto K, Kitai Y, Toriu N, Yamamoto S, Mizuta K, Saitou M, et al. Expression pattern of Runt-related transcription factor (RUNX) family members and the role of RUNX1 during kidney development. Biochem Biophys Res Commun. 2024;722:150155 pubmed publisher
Waters B, Birman Z, Wagner M, Lemanski J, Blum B. Islet architecture in adult mice is actively maintained by Robo2 expression in β cells. Dev Biol. 2024;505:122-129 pubmed publisher
Lu J, Chueh K, Juan T, Mao J, Lin R, Lee Y, et al. Effects of Therapeutic Platelet-Rich Plasma on Overactive Bladder via Modulating Hyaluronan Synthesis in Ovariectomized Rat. Int J Mol Sci. 2023;24: pubmed publisher
Chen H, Barske L, Talbot J, Dinwoodie O, Roberts R, Farmer D, et al. Nuclear receptor Nr5a2 promotes diverse connective tissue fates in the jaw. Dev Cell. 2023;58:461-473.e7 pubmed publisher
Deepe R, Drummond J, Wolters R, Fitzgerald E, Tarolli H, Harvey A, et al. Sox9 Expression in the Second Heart Field; A Morphological Assessment of the Importance to Cardiac Development with Emphasis on Atrioventricular Septation. J Cardiovasc Dev Dis. 2022;9: pubmed publisher
Baek I, Bello A, Jeon J, Arai Y, Cha B, Kim B, et al. Therapeutic potential of epiphyseal growth plate cells for bone regeneration in an osteoporosis model. J Tissue Eng. 2022;13:20417314221116754 pubmed publisher
Liu Q, Guo Q, Guo W, Song S, Wang N, Chen X, et al. Loss of CEP70 function affects acrosome biogenesis and flagella formation during spermiogenesis. Cell Death Dis. 2021;12:478 pubmed publisher
Winkler A, Wrzos C, Haberl M, Weil M, Gao M, Mobius W, et al. Blood-brain barrier resealing in neuromyelitis optica occurs independently of astrocyte regeneration. J Clin Invest. 2021;131: pubmed publisher
Deepe R, Fitzgerald E, Wolters R, Drummond J, Guzman K, Hoff M, et al. The Mesenchymal Cap of the Atrial Septum and Atrial and Atrioventricular Septation. J Cardiovasc Dev Dis. 2020;7: pubmed publisher
Stegen S, Rinaldi G, Loopmans S, Stockmans I, Moermans K, Thienpont B, et al. Glutamine Metabolism Controls Chondrocyte Identity and Function. Dev Cell. 2020;53:530-544.e8 pubmed publisher
van Gastel N, Stegen S, Eelen G, Schoors S, Carlier A, Daniëls V, et al. Lipid availability determines fate of skeletal progenitor cells via SOX9. Nature. 2020;579:111-117 pubmed publisher
Tournaire G, Stegen S, Giacomini G, Stockmans I, Moermans K, Carmeliet G, et al. Nestin-GFP transgene labels skeletal progenitors in the periosteum. Bone. 2020;133:115259 pubmed publisher
Pham T, Fan C, Pfeifer D, Zhang H, Sun X. Image-Based Network Analysis of DNp73 Expression by Immunohistochemistry in Rectal Cancer Patients. Front Physiol. 2019;10:1551 pubmed publisher
Cheng B, Liu Y, Zhao Y, Li Q, Liu Y, Wang J, et al. The role of anthrax toxin protein receptor 1 as a new mechanosensor molecule and its mechanotransduction in BMSCs under hydrostatic pressure. Sci Rep. 2019;9:12642 pubmed publisher
Roberts R, Bobzin L, Teng C, Pal D, Tuzon C, Schweitzer R, et al. FGF signaling patterns cell fate at the interface between tendon and bone. Development. 2019;146: pubmed publisher
Guo J, Jia R. Splicing factor poly(rC)-binding protein 1 is a novel and distinctive tumor suppressor. J Cell Physiol. 2018;234:33-41 pubmed publisher
Gonzalez R, De La Rosa A, Rufini A, Rodríguez Hernández M, Navarro Villarán E, Marchal T, et al. Role of p63 and p73 isoforms on the cell death in patients with hepatocellular carcinoma submitted to orthotopic liver transplantation. PLoS ONE. 2017;12:e0174326 pubmed publisher
Leijten J, Teixeira L, Bolander J, Ji W, Vanspauwen B, Lammertyn J, et al. Bioinspired seeding of biomaterials using three dimensional microtissues induces chondrogenic stem cell differentiation and cartilage formation under growth factor free conditions. Sci Rep. 2016;6:36011 pubmed publisher
Morandi E, Verstappen R, Zwierzina M, Geley S, Pierer G, Ploner C. ITGAV and ITGA5 diversely regulate proliferation and adipogenic differentiation of human adipose derived stem cells. Sci Rep. 2016;6:28889 pubmed publisher
Prabhu V, Hong B, Allen J, Zhang S, Lulla A, Dicker D, et al. Small-Molecule Prodigiosin Restores p53 Tumor Suppressor Activity in Chemoresistant Colorectal Cancer Stem Cells via c-Jun-Mediated ΔNp73 Inhibition and p73 Activation. Cancer Res. 2016;76:1989-99 pubmed publisher
Brenig B, Duan Y, Xing Y, Ding N, Huang L, Schütz E. Porcine SOX9 Gene Expression Is Influenced by an 18 bp Indel in the 5'-Untranslated Region. PLoS ONE. 2015;10:e0139583 pubmed publisher
Chen Y, Chen H, Chien C, Wu S, Ho Y, Yu C, et al. Contribution of Mature Hepatocytes to Biliary Regeneration in Rats with Acute and Chronic Biliary Injury. PLoS ONE. 2015;10:e0134327 pubmed publisher
Hassan H, Dave B, Singh R. TP73, an under-appreciated player in non-Hodgkin lymphoma pathogenesis and management. Curr Mol Med. 2014;14:432-9 pubmed
Hassan H, Varney M, Jain S, Weisenburger D, Singh R, Dave B. Disruption of chromosomal locus 1p36 differentially modulates TAp73 and ΔNp73 expression in follicular lymphoma. Leuk Lymphoma. 2014;55:2924-31 pubmed publisher
Veselska R, Neradil J, Nekulova M, Dobrucka L, Vojtesek B, Sterba J, et al. Intracellular distribution of the ?Np73 protein isoform in medulloblastoma cells: a study with newly generated rabbit polyclonal antibodies. Histol Histopathol. 2013;28:913-24 pubmed publisher
Shin A, Joo J, Bak J, Yang H, Kim J, Park S, et al. Site-specific risk factors for colorectal cancer in a Korean population. PLoS ONE. 2011;6:e23196 pubmed publisher
Rastogi S, Rizwani W, Joshi B, Kunigal S, Chellappan S. TNF-? response of vascular endothelial and vascular smooth muscle cells involve differential utilization of ASK1 kinase and p73. Cell Death Differ. 2012;19:274-83 pubmed publisher
Leonard M, Kommagani R, Payal V, Mayo L, Shamma H, Kadakia M. ?Np63? regulates keratinocyte proliferation by controlling PTEN expression and localization. Cell Death Differ. 2011;18:1924-33 pubmed publisher
Accardi R, Scalise M, Gheit T, Hussain I, Yue J, Carreira C, et al. IkappaB kinase beta promotes cell survival by antagonizing p53 functions through DeltaNp73alpha phosphorylation and stabilization. Mol Cell Biol. 2011;31:2210-26 pubmed publisher
Nekulova M, Zitterbart K, Sterba J, Veselska R. Analysis of the intracellular localization of p73 N-terminal protein isoforms TAp73 and ?Np73 in medulloblastoma cell lines. J Mol Histol. 2010;41:267-75 pubmed publisher
Vilgelm A, Washington M, Wei J, Chen H, Prassolov V, Zaika A. Interactions of the p53 protein family in cellular stress response in gastrointestinal tumors. Mol Cancer Ther. 2010;9:693-705 pubmed publisher
Wilhelm M, Rufini A, Wetzel M, Tsuchihara K, Inoue S, Tomasini R, et al. Isoform-specific p73 knockout mice reveal a novel role for delta Np73 in the DNA damage response pathway. Genes Dev. 2010;24:549-60 pubmed publisher
Lefkimmiatis K, Caratozzolo M, Merlo P, D Erchia A, Navarro B, Levrero M, et al. p73 and p63 sustain cellular growth by transcriptional activation of cell cycle progression genes. Cancer Res. 2009;69:8563-71 pubmed publisher
Rosenbluth J, Johnson K, Tang L, Triplett T, Pietenpol J. Evaluation of p63 and p73 antibodies for cross-reactivity. Cell Cycle. 2009;8:3702-6 pubmed
Marqués García F, Ferrandiz N, Fernández Alonso R, González Cano L, Herreros Villanueva M, Rosa Garrido M, et al. p73 plays a role in erythroid differentiation through GATA1 induction. J Biol Chem. 2009;284:21139-56 pubmed publisher
Tomasini R, Tsuchihara K, Wilhelm M, Fujitani M, Rufini A, Cheung C, et al. TAp73 knockout shows genomic instability with infertility and tumor suppressor functions. Genes Dev. 2008;22:2677-91 pubmed publisher
Rosenbluth J, Mays D, Pino M, Tang L, Pietenpol J. A gene signature-based approach identifies mTOR as a regulator of p73. Mol Cell Biol. 2008;28:5951-64 pubmed publisher
Lunghi P, Giuliani N, Mazzera L, Lombardi G, Ricca M, Corradi A, et al. Targeting MEK/MAPK signal transduction module potentiates ATO-induced apoptosis in multiple myeloma cells through multiple signaling pathways. Blood. 2008;112:2450-62 pubmed publisher
Mor I, Bruck T, Greenberg D, Berson A, Schreiber L, Grisaru D, et al. Alternate AChE-R variants facilitate cellular metabolic activity and resistance to genotoxic stress through enolase and RACK1 interactions. Chem Biol Interact. 2008;175:11-21 pubmed publisher
Cancino G, Toledo E, Leal N, Hernandez D, Yévenes L, Inestrosa N, et al. STI571 prevents apoptosis, tau phosphorylation and behavioural impairments induced by Alzheimer's beta-amyloid deposits. Brain. 2008;131:2425-42 pubmed publisher
Righetti S, Perego P, Carenini N, Zunino F. Cooperation between p53 and p73 in cisplatin-induced apoptosis in ovarian carcinoma cells. Cancer Lett. 2008;263:140-4 pubmed publisher
Mor I, Sklan E, Podoly E, Pick M, Kirschner M, Yogev L, et al. Acetylcholinesterase-R increases germ cell apoptosis but enhances sperm motility. J Cell Mol Med. 2008;12:479-95 pubmed publisher
Zitterbart K, Zavrelova I, Kadlecova J, Spesna R, Kratochvilova A, Pavelka Z, et al. p73 expression in medulloblastoma: TAp73/DeltaNp73 transcript detection and possible association of p73alpha/DeltaNp73 immunoreactivity with survival. Acta Neuropathol. 2007;114:641-50 pubmed
Castellino R, De Bortoli M, Lin L, Skapura D, Rajan J, Adesina A, et al. Overexpressed TP73 induces apoptosis in medulloblastoma. BMC Cancer. 2007;7:127 pubmed
Toscano F, Parmentier B, Fajoui Z, Estornes Y, Chayvialle J, Saurin J, et al. p53 dependent and independent sensitivity to oxaliplatin of colon cancer cells. Biochem Pharmacol. 2007;74:392-406 pubmed
Bozzetti C, Nizzoli R, Musolino A, Martella E, Crafa P, Lagrasta C, et al. p73 and p53 pathway in human breast cancers. J Clin Oncol. 2007;25:1451-3; author reply 1453-4 pubmed
Cabrera Socorro A, Pueyo Morlans M, Suarez Sola M, Gonzalez Delgado F, Castañeyra Perdomo A, Marin M, et al. Multiple isoforms of the tumor protein p73 are expressed in the adult human telencephalon and choroid plexus and present in the cerebrospinal fluid. Eur J Neurosci. 2006;23:2109-18 pubmed
Dominguez G, Garcia J, Peña C, Silva J, Garcia V, Martínez L, et al. DeltaTAp73 upregulation correlates with poor prognosis in human tumors: putative in vivo network involving p73 isoforms, p53, and E2F-1. J Clin Oncol. 2006;24:805-15 pubmed
Saifudeen Z, Diavolitsis V, Stefkova J, Dipp S, Fan H, El Dahr S. Spatiotemporal switch from DeltaNp73 to TAp73 isoforms during nephrogenesis: impact on differentiation gene expression. J Biol Chem. 2005;280:23094-102 pubmed
Sayan A, Paradisi A, Vojtesek B, Knight R, Melino G, Candi E. New antibodies recognizing p73: comparison with commercial antibodies. Biochem Biophys Res Commun. 2005;330:186-93 pubmed
Papoutsaki M, Lanza M, Marinari B, Nistico S, Moretti F, Levrero M, et al. The p73 gene is an anti-tumoral target of the RARbeta/gamma-selective retinoid tazarotene. J Invest Dermatol. 2004;123:1162-8 pubmed
Tomkova K, Belkhiri A, El Rifai W, Zaika A. p73 isoforms can induce T-cell factor-dependent transcription in gastrointestinal cells. Cancer Res. 2004;64:6390-3 pubmed
Lunghi P, Costanzo A, Levrero M, Bonati A. Treatment with arsenic trioxide (ATO) and MEK1 inhibitor activates the p73-p53AIP1 apoptotic pathway in leukemia cells. Blood. 2004;104:519-25 pubmed
Vossio S, Palescandolo E, Pediconi N, Moretti F, Balsano C, Levrero M, et al. DN-p73 is activated after DNA damage in a p53-dependent manner to regulate p53-induced cell cycle arrest. Oncogene. 2002;21:3796-803 pubmed
product information
master code :
NBP1-85551
SKU :
NBP1-85551
product name :
SOX9 Antibody - BSA Free
unit size :
0.1 ml
description :
The SOX9 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to SOX9. This antibody reacts with canine,human,mouse,porcine,rat. The SOX9 Antibody - BSA Free has been validated for the following applications: EMSA,IF/IHC,IHF-Fr,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Immunohistochemistry-Frozen,Simple Western,Gel Supershift Assay,Knockdown Validated,Immunocytochemistry/ Immunofluorescence.
target :
SOX9
category :
Primary Antibodies
buffer :
PBS (pH 7.2) and 40% Glycerol
clonality :
Polyclonal
conjugate :
Unconjugated
host :
Rabbit
immunogen :
SQRTHIKTEQLSPSHYSEQQQHSPQQIAYSPFNLPHYSP
SYPPITRSQYDYTDHQNSSSYYSHAAGQGTGLYSTFTYM
NPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYTQLTR
This antibody was developed against Recombinant Protein corresponding to amino acids:
isotype :
IgG
purity :
Immunogen affinity purified
species :
Canine,Human,Mouse,Porcine,Rat
gene symbol :
SOX9
Antibody validation :
Knockout/Knockdown
accessionNumbers :
P48436
applications :
EMSA,IF/IHC,IHF-Fr,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Immunohistochemistry-Frozen,Simple Western,Gel Supershift Assay,Knockdown Validated,Immunocytochemistry/ Immunofluorescence
USD :
579 USD
alt names :
campomelic dysplasia, autosomal sex-reversal, CMD 1, CMD1, CMPD1, SRA1SRY (sex-determining region Y)-box 9 protein, SRY (sex determining region Y)-box 9, SRY-related HMG-box, gene 9, transcription factor SOX-9
storage :
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
more info or order :
company information
Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com
3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.