COX-1 Antibody - BSA Free | Novus Biologicals NBP1-85500 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

COX-1 Antibody - BSA Free

catalog :

NBP1-85500

quantity :

0.1 ml (also 25 ul)

price :

559 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 6

Reference
Liu C, Tate T, Batourina E, Truschel S, POTTER S, Adam M, et al. Pparg promotes differentiation and regulates mitochondrial gene expression in bladder epithelial cells. Nat Commun. 2019;10:4589 pubmed publisher
David B, Curtin J, Goldberg D, Scorpio K, Kandaswamy V, Hill C. Hypoxia-Inducible Factor 1α (HIF-1α) Counteracts the Acute Death of Cells Transplanted into the Injured Spinal Cord. Eneuro. 2020;7: pubmed publisher
Lin X, Ma Y, Qian T, Yao J, Mi Y, Zhang C. Basic fibroblast growth factor promotes prehierarchical follicle growth and yolk deposition in the chicken. Theriogenology. 2019;139:90-97 pubmed publisher
Lu Z, Lin V, May A, Che B, Xiao X, Shaw D, et al. HTRA1 synergizes with oxidized phospholipids in promoting inflammation and macrophage infiltration essential for ocular VEGF expression. PLoS ONE. 2019;14:e0216808 pubmed publisher
Uram Ł, Filipowicz A, Misiorek M, Pieńkowska N, Markowicz J, Wałajtys Rode E, et al. Biotinylated PAMAM G3 dendrimer conjugated with celecoxib and/or Fmoc-l-Leucine and its cytotoxicity for normal and cancer human cell lines. Eur J Pharm Sci. 2018;124:1-9 pubmed publisher
Soto S, Melo J, Marchesi G, Lopes K, Veras M, Oliveira I, et al. Exposure to fine particulate matter in the air alters placental structure and the renin-angiotensin system. PLoS ONE. 2017;12:e0183314 pubmed publisher

product information

master code :

NBP1-85500

SKU :

NBP1-85500

product name :

COX-1 Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The COX-1 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to COX-1. This antibody reacts with human,mouse. The COX-1 Antibody - BSA Free has been validated for the following applications: Western Blot,Immunohistochemistry-Paraffin,Immunohistochemistry,Simple Western,Immunocytochemistry/ Immunofluorescence.

target :

COX-1

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

MPDSFKVGSQEYSYEQFLFNTSMLVDYGVEALVDAFSRQ
IAGRIGGGRNMDHHILHVAVDVIRESREMRLQPFNEYRK
RFGMKPYTSFQELVGEKEMAAELEELYGDIDALEFYPGL
LLEKCHPNSIFGESMIEIGAPFSLKGLLGN
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human,Mouse

gene symbol :

PTGS1

Antibody validation :

Orthogonal Validation

applications :

Western Blot,Immunohistochemistry-Paraffin,Immunohistochemistry,Simple Western,Immunocytochemistry/ Immunofluorescence

USD :

559 USD

alt names :

COX-1, COX1PGG/HS, COX3, Cyclooxygenase-1, EC 1.14.99.1, PCOX1, PGH synthase 1, PGHS1, PGHS-1PHS1, PHS 1, prostaglandin G/H synthase 1, prostaglandin G/H synthase and cyclooxygenase, Prostaglandin H2 synthase 1, Prostaglandin-endoperoxide synthase 1, prostaglandin-endoperoxide synthase 1 (prostaglandin G/H synthase andcyclooxygenase), PTGHS

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage