product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
INTS11 Antibody - BSA Free
catalog :
NBP1-85474
quantity :
0.1 ml (also 25 ul)
price :
529 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
immunohistochemistry, immunohistochemistry - paraffin section
more info or order :
product information
master code :
NBP1-85474
SKU :
NBP1-85474
product name :
INTS11 Antibody - BSA Free
unit size :
0.1 ml (also 25 ul)
description :
The INTS11 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to INTS11. This antibody reacts with human. The INTS11 Antibody - BSA Free has been validated for the following applications: Immunohistochemistry,Immunohistochemistry-Paraffin.
target :
INTS11
category :
Primary Antibodies
buffer :
PBS (pH 7.2) and 40% Glycerol
clonality :
Polyclonal
conjugate :
Unconjugated
host :
Rabbit
immunogen :
LVGQAEPESVLLVHGEAKKMEFLKQKIEQELRVNCYMPA
NGETVTLPTSPSIPVGISLGLLKREMAQGLLPEAKKPRL
LHGTLIMKDSNFRLVSSEQALK
This antibody was developed against Recombinant Protein corresponding to amino acids:
NGETVTLPTSPSIPVGISLGLLKREMAQGLLPEAKKPRL
LHGTLIMKDSNFRLVSSEQALK
This antibody was developed against Recombinant Protein corresponding to amino acids:
isotype :
IgG
purity :
Immunogen affinity purified
species :
Human
gene symbol :
INTS11
applications :
Immunohistochemistry,Immunohistochemistry-Paraffin
USD :
529 USD
alt names :
cleavage and polyadenylation specific factor 3-like, Cleavage and polyadenylation-specific factor 3-like protein, CPSF3-like protein, EC 3.1.27, EC 3.1.27.-, FLJ20542, INT11, integrator complex subunit 11, INTS11FLJ13294, Protein related to CPSF subunits of 68 kDa, RC68, RC-68CPSF73L, related to CPSF subunits 68 kDa
storage :
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
more info or order :
company information

Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
related products
browse more products
questions and comments
