Cyclophilin B Antibody - BSA Free | Novus Biologicals NBP1-85358 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

Cyclophilin B Antibody - BSA Free

catalog :

NBP1-85358

quantity :

0.1 ml (also 25 ul)

price :

559 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

clone name :

5.00E+10

reactivity :

human, mouse, rat

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 7

Reference
Maeder C, Kim J, Liang X, Kaganovsky K, Shen A, Li Q, et al. The THO Complex Coordinates Transcripts for Synapse Development and Dopamine Neuron Survival. Cell. 2018;174:1436-1449.e20 pubmed publisher
Chen Y, Tsai C, Wang P, Teng S. SMYD3 Promotes Homologous Recombination via Regulation of H3K4-mediated Gene Expression. Sci Rep. 2017;7:3842 pubmed publisher
Hsu W, Shih J, Shih J, Du J, Teng S, Huang L, et al. Cellular protein HAX1 interacts with the influenza A virus PA polymerase subunit and impedes its nuclear translocation. J Virol. 2013;87:110-23 pubmed publisher
Lopitz Otsoa F, Rodriguez Suarez E, Aillet F, Casado Vela J, Lang V, Matthiesen R, et al. Integrative analysis of the ubiquitin proteome isolated using Tandem Ubiquitin Binding Entities (TUBEs). J Proteomics. 2012;75:2998-3014 pubmed publisher
Wong C, Hou P, Tseng S, Chien C, Wu K, Chen H, et al. Krüppel-like transcription factor 4 contributes to maintenance of telomerase activity in stem cells. Stem Cells. 2010;28:1510-7 pubmed publisher
Guo S, Hakimi M, Baillat D, Chen X, Farber M, Klein Szanto A, et al. Linking transcriptional elongation and messenger RNA export to metastatic breast cancers. Cancer Res. 2005;65:3011-6 pubmed
Bounpheng M, Melnikova I, Dodds S, Chen H, Copeland N, Gilbert D, et al. Characterization of the mouse JAB1 cDNA and protein. Gene. 2000;242:41-50 pubmed

product information

master code :

NBP1-85358

SKU :

NBP1-85358

product name :

Cyclophilin B Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The Cyclophilin B Antibody - BSA Free from Novus is a rabbit polyclonal antibody to Cyclophilin B. This antibody reacts with human,mouse,rat. The Cyclophilin B Antibody - BSA Free has been validated for the following applications: Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Simple Western,Knockdown Validated,Immunocytochemistry/ Immunofluorescence.

target :

Cyclophilin B

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

concentration :

0.1 mg/ml

conjugate :

Unconjugated

host :

Rabbit

immunogen :

LKHYGPGWVSMANAGKDTNGSQFFITTVKTAWLDGKHVV
FGKVLEGMEVVRKVESTKTDSRDKPLKDVIIADCGKIEV
EKPFAIAKE
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human,Mouse,Rat

gene symbol :

PPIB

Antibody validation :

Knockout/Knockdown

applications :

Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Simple Western,Knockdown Validated,Immunocytochemistry/ Immunofluorescence

USD :

559 USD

alt names :

Cyclophilin B, cyclophilin-like protein, CYPBEC 5.2.1.8, CYP-S1, MGC2224, OI9MGC14109, peptidyl-prolyl cis-trans isomerase B, peptidylprolyl isomerase B (cyclophilin B), PPIase B, Rotamase B, S-cyclophilin, SCYLP

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage