Villin 1 Antibody - BSA Free | Novus Biologicals NBP1-85335 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

Villin 1 Antibody - BSA Free

catalog :

NBP1-85335

quantity :

0.1 ml (also 25 ul)

price :

529 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

clone name :

OTI3F5

reactivity :

human

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 6

Reference
Takahashi J, Sugihara H, Kato S, Kawasaki S, Nagata S, Okamoto R, et al. Controlled aggregative assembly to form self-organizing macroscopic human intestine from induced pluripotent stem cells. Cell Rep Methods. 2024;4:100930 pubmed publisher
Prescott R, Pankow A, de Vries M, Crosse K, Patel R, Alu M, et al. A comparative study of in vitro air-liquid interface culture models of the human airway epithelium evaluating cellular heterogeneity and gene expression at single cell resolution. Respir Res. 2023;24:213 pubmed publisher
Prescott R, Pankow A, de Vries M, Crosse K, Patel R, Alu M, et al. A comparative study of in vitro air-liquid interface culture models of the human airway epithelium evaluating cellular heterogeneity and gene expression at single cell resolution. bioRxiv. 2023;: pubmed publisher
Takahashi J, Mizutani T, Sugihara H, Nagata S, Kato S, Hiraguri Y, et al. Suspension culture in a rotating bioreactor for efficient generation of human intestinal organoids. Cell Rep Methods. 2022;2:100337 pubmed publisher
Zhu Z, Achreja A, Meurs N, Animasahun O, Owen S, Mittal A, et al. Tumour-reprogrammed stromal BCAT1 fuels branched-chain ketoacid dependency in stromal-rich PDAC tumours. Nat Metab. 2020;: pubmed publisher
Li H, Ye D, Xie W, Hua F, Yang Y, Wu J, et al. Defect of branched-chain amino acid metabolism promotes the development of Alzheimer's disease by targeting the mTOR signaling. Biosci Rep. 2018;38: pubmed publisher

product information

master code :

NBP1-85335

SKU :

NBP1-85335

product name :

Villin 1 Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The Villin 1 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to Villin 1. This antibody reacts with human. The Villin 1 Antibody - BSA Free has been validated for the following applications: Immunocytochemistry/ Immunofluorescence,IF/IHC,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin.

target :

Villin 1

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

NGPESTRMERLRGMTLAKEIRDQERGGRTYVGVVDGENE
LASPKLMEVMNHVLGKRRELKAAVPDTVVEPALKAALKL
YHVSDSEGNLVVREVATRPLTQDLLSHE
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human

theoretical molecular weight :

93 kDa

gene symbol :

VIL1

Antibody validation :

Independent Anitbodies

accessionNumbers :

P09327

applications :

Immunocytochemistry/ Immunofluorescence,IF/IHC,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin

USD :

529 USD

alt names :

D2S1471, VIL, villin 1, villin-1

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage