product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
DAP5 Antibody - BSA Free
catalog :
NBP1-85310
quantity :
0.1 ml (also 25 ul)
price :
499 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry, immunohistochemistry - paraffin section
more info or order :
product information
master code :
NBP1-85310
SKU :
NBP1-85310
product name :
DAP5 Antibody - BSA Free
unit size :
0.1 ml (also 25 ul)
description :
The DAP5 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to DAP5. This antibody reacts with human,mouse,rat. The DAP5 Antibody - BSA Free has been validated for the following applications: Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin.
target :
DAP5
category :
Primary Antibodies
buffer :
PBS (pH 7.2) and 40% Glycerol
clonality :
Polyclonal
conjugate :
Unconjugated
host :
Rabbit
immunogen :
KYSSLYAQLCLRLAEDAPNFDGPAAEGQPGQKQSTTFRR
LLISKLQDEFENRTRNVDVYDKRENPLLPEEEEQRAIAK
IKMLGNIKFIGELGKLDLIHESILHKCIKTLLEKKKRVQ
LKDMGEDLECLCQIMRTVGPRLDHERAKS
This antibody was developed against Recombinant Protein corresponding to amino acids:
LLISKLQDEFENRTRNVDVYDKRENPLLPEEEEQRAIAK
IKMLGNIKFIGELGKLDLIHESILHKCIKTLLEKKKRVQ
LKDMGEDLECLCQIMRTVGPRLDHERAKS
This antibody was developed against Recombinant Protein corresponding to amino acids:
isotype :
IgG
purity :
Immunogen affinity purified
species :
Human,Mouse,Rat
gene symbol :
EIF4G2
Antibody validation :
Independent Anitbodies
applications :
Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin
USD :
499 USD
alt names :
aging-associated protein 1, DAP-5, DAP5AAG1, Death-associated protein 5, eIF4G 2, eIF-4G 2, eIF-4-gamma 2, eukaryotic translation initiation factor 4 gamma 2, eukaryotic translation initiation factor 4 gamma, 2, eukaryotic translation initiation factor 4G-like 1, FLJ41344, NAT1, p97
storage :
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
more info or order :
company information

Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
related products
browse more products
questions and comments
