CRISPLD2 Antibody - BSA Free | Novus Biologicals NBP1-85143 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

CRISPLD2 Antibody - BSA Free

catalog :

NBP1-85143

quantity :

0.1 ml (also 25 ul)

price :

529 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

clone name :

923B7

reactivity :

human, mouse

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 11

Reference
Jackson R, Griesel B, Short K, Sparling D, Freeman W, Olson A. Weight Loss Results in Increased Expression of Anti-Inflammatory Protein CRISPLD2 in Mouse Adipose Tissue. Obesity (Silver Spring). 2019;27:2025-2036 pubmed publisher
Nasr N, Lai J, Botting R, Mercier S, Harman A, Kim M, et al. Inhibition of two temporal phases of HIV-1 transfer from primary Langerhans cells to T cells: the role of langerin. J Immunol. 2014;193:2554-64 pubmed publisher
Luckashenak N, Wähe A, Breit K, Brakebusch C, Brocker T. Rho-family GTPase Cdc42 controls migration of Langerhans cells in vivo. J Immunol. 2013;190:27-35 pubmed publisher
Hitzler M, Majdic O, Heine G, Worm M, Ebert G, Luch A, et al. Human Langerhans cells control Th cells via programmed death-ligand 1 in response to bacterial stimuli and nickel-induced contact allergy. PLoS ONE. 2012;7:e46776 pubmed publisher
Iram N, Mildner M, Prior M, Petzelbauer P, Fiala C, Hacker S, et al. Age-related changes in expression and function of Toll-like receptors in human skin. Development. 2012;139:4210-9 pubmed publisher
Segura E, Valladeau Guilemond J, Donnadieu M, Sastre Garau X, Soumelis V, Amigorena S. Characterization of resident and migratory dendritic cells in human lymph nodes. J Exp Med. 2012;209:653-60 pubmed publisher
Hervouet C, Luci C, Rol N, Rousseau D, Kissenpfennig A, Malissen B, et al. Langerhans cells prime IL-17-producing T cells and dampen genital cytotoxic responses following mucosal immunization. J Immunol. 2010;184:4842-51 pubmed publisher
Nfon C, Dawson H, Toka F, Golde W. Langerhans cells in porcine skin. Vet Immunol Immunopathol. 2008;126:236-47 pubmed publisher
Douillard P, Stoitzner P, Tripp C, Clair Moninot V, Ait Yahia S, McLellan A, et al. Mouse lymphoid tissue contains distinct subsets of langerin/CD207 dendritic cells, only one of which represents epidermal-derived Langerhans cells. J Invest Dermatol. 2005;125:983-94 pubmed
Movassagh M, Spatz A, Davoust J, Lebecque S, Romero P, Pittet M, et al. Selective accumulation of mature DC-Lamp+ dendritic cells in tumor sites is associated with efficient T-cell-mediated antitumor response and control of metastatic dissemination in melanoma. Cancer Res. 2004;64:2192-8 pubmed
Valladeau J, Clair Moninot V, Dezutter Dambuyant C, Pin J, Kissenpfennig A, Mattei M, et al. Identification of mouse langerin/CD207 in Langerhans cells and some dendritic cells of lymphoid tissues. J Immunol. 2002;168:782-92 pubmed

product information

master code :

NBP1-85143

SKU :

NBP1-85143

product name :

CRISPLD2 Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The CRISPLD2 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to CRISPLD2. This antibody reacts with human,mouse. The CRISPLD2 Antibody - BSA Free has been validated for the following applications: IF/IHC,Western Blot,Immunohistochemistry,Immunohistochemistry-Paraffin.

target :

CRISPLD2

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

VCNYSPKGNWIGEAPYKNGRPCSECPPSYGGSCRNNLCY
REETYTPKPETDEMNEVETAPIPEENHVWLQPRVMRPTK
PKKTSAVNYMTQVVRCDTKMKDRCKGSTCNRYQCPAGCL
NHKAKIFGSLFYESSS
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human,Mouse

gene symbol :

CRISPLD2

applications :

IF/IHC,Western Blot,Immunohistochemistry,Immunohistochemistry-Paraffin

USD :

529 USD

alt names :

CRISP11, CRISP-11, Cysteine-rich secretory protein 11, cysteine-rich secretory protein LCCL domain containing 2, cysteine-rich secretory protein LCCL domain-containing 2, DKFZP434B044, LCCL domain containing cysteine-rich secretory protein 2, LCCL domain-containing cysteine-rich secretory protein 2, LCRISP2, MGC74865

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage