Tight Junction Protein 1 Antibody - BSA Free | Novus Biologicals NBP1-85047 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

Tight Junction Protein 1 Antibody - BSA Free

catalog :

NBP1-85047

quantity :

0.1 ml

price :

579 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 19

Reference
Wendland R, Tucker B, Worthington K. Influence of Substrate Stiffness on iPSC-Derived Retinal Pigmented Epithelial Cells. Stem Cells Transl Med. 2024;13:582-592 pubmed publisher
Cheng Y, Li J, Zhang X, Li Y, Shi X, Shi R, et al. Protective Effect of Qingchang Wenzhong Decoction on Colitis and Colitis-Related Carcinogenesis by Regulating Inflammation and Intestinal Fibrosis. J Inflamm Res. 2023;16:1479-1495 pubmed publisher
Ji S, You Y, Peng B, Zhong T, Kuang Y, Li S, et al. Multi-omics analysis reveals the metabolic regulators of duodenal low-grade inflammation in a functional dyspepsia model. Front Immunol. 2022;13:944591 pubmed publisher
Roşu G, Mateescu V, Simionescu A, Istrate Ofiţeru A, Curc x103 G, Pirici I, et al. Subtle vascular and astrocytic changes in the brain of coronavirus disease 2019 (COVID-19) patients. Eur J Neurol. 2022;29:3676-3692 pubmed publisher
Yang A, Lin C, Liu S, Syu G, Sun H, Lee K, et al. Saccharomyces Boulardii Ameliorates Non-alcoholic Steatohepatitis in Mice Induced by a Methionine-Choline-Deficient Diet Through Gut-Liver Axis. Front Microbiol. 2022;13:887728 pubmed publisher
Fu Q, Lin Q, Chen D, Yu B, Luo Y, Zheng P, et al. β-defensin 118 attenuates inflammation and injury of intestinal epithelial cells upon enterotoxigenic Escherichia coli challenge. BMC Vet Res. 2022;18:142 pubmed publisher
Song K, Zeng X, Xie X, Zhu R, Liang J, Chen G, et al. Dl-3-n-butylphthalide attenuates brain injury caused by cortical infarction accompanied by cranial venous drainage disturbance. Stroke Vasc Neurol. 2022;7:222-236 pubmed publisher
Spindler L, Feuerhake A, Ladel S, G xfc nday C, Flamm J, G xfc nday T xfc reli N, et al. Nano-in-Micro-Particles Consisting of PLGA Nanoparticles Embedded in Chitosan Microparticles via Spray-Drying Enhances Their Uptake in the Olfactory Mucosa. Front Pharmacol. 2021;12:732954 pubmed publisher
Lassiter R, Merchen T, Fang X, Wang Y. Protective Role of Kynurenine 3-Monooxygenase in Allograft Rejection and Tubular Injury in Kidney Transplantation. Front Immunol. 2021;12:671025 pubmed publisher
Boul M, Benzoubir N, Messina A, Ghasemi R, Mosbah I, Duclos Vall xe9 e J, et al. A versatile microfluidic tool for the 3D culture of HepaRG cells seeded at various stages of differentiation. Sci Rep. 2021;11:14075 pubmed publisher
Chen Y, Tristan C, Chen L, Jovanovic V, Malley C, Chu P, et al. A versatile polypharmacology platform promotes cytoprotection and viability of human pluripotent and differentiated cells. Nat Methods. 2021;18:528-541 pubmed publisher
Quan W, Luo Q, Hao W, Tomic I, Furihata T, Schulz Schäffer W, et al. Haploinsufficiency of microglial MyD88 ameliorates Alzheimer's pathology and vascular disorders in APP/PS1-transgenic mice. Glia. 2021;69:1987-2005 pubmed publisher
Abbassi L, El Hayek S, Carvalho K, Wang W, Yang Q, Granados Aparici S, et al. Epidermal growth factor receptor signaling uncouples germ cells from the somatic follicular compartment at ovulation. Nat Commun. 2021;12:1438 pubmed publisher
Hahn L, Helmrich N, Herebian D, Mayatepek E, Drebber U, Domann E, et al. IL-13 as Target to Reduce Cholestasis and Dysbiosis in Abcb4 Knockout Mice. Cells. 2020;9: pubmed publisher
Su C, Liu S, Ma X, Yang X, Liu J, Zheng P, et al. Decitabine attenuates dextran sodium sulfate‑induced ulcerative colitis through regulation of immune regulatory cells and intestinal barrier. Int J Mol Med. 2020;46:583-594 pubmed publisher
Liu X, Zhang B, Liu H, Zhang G, Zhao J, Liu L, et al. Determination of the available energy values and amino acid digestibility of Flammulina velutipes stem waste and its effects on carcass trait and meat quality fed to growing-finishing pigs. J Anim Sci Biotechnol. 2020;11:41 pubmed publisher
Caron J, Pène V, Tolosa L, Villaret M, Luce E, Fourrier A, et al. Low-density lipoprotein receptor-deficient hepatocytes differentiated from induced pluripotent stem cells allow familial hypercholesterolemia modeling, CRISPR/Cas-mediated genetic correction, and productive hepatitis C virus infection. Stem Cell Res Ther. 2019;10:221 pubmed publisher
Coffin K, Liu J, Warren T, Blancett C, Kuehl K, Nichols D, et al. Persistent Marburg Virus Infection in the Testes of Nonhuman Primate Survivors. Cell Host Microbe. 2018;24:405-416.e3 pubmed publisher
Liu M, Yang J, Zhang Y, Zhou Z, Cui X, Zhang L, et al. ZIP4 Promotes Pancreatic Cancer Progression by Repressing ZO-1 and Claudin-1 through a ZEB1-Dependent Transcriptional Mechanism. Clin Cancer Res. 2018;24:3186-3196 pubmed publisher

product information

master code :

NBP1-85047

SKU :

NBP1-85047

product name :

Tight Junction Protein 1 Antibody - BSA Free

unit size :

0.1 ml

description :

The Tight Junction Protein 1 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to Tight Junction Protein 1. This antibody reacts with human,mouse,porcine,rat. The Tight Junction Protein 1 Antibody - BSA Free has been validated for the following applications: Immunohistochemistry,Western Blot,Immunocytochemistry/ Immunofluorescence,IF/IHC,Simple Western,Immunohistochemistry-Paraffin.

target :

Tight Junction Protein 1

category :

Primary Antibodies

buffer :

PBS (pH 7.2), 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

RKLYERSHKLRKNNHHLFTTTINLNSMNDGWYGALKEAI
QQQQNQLVWVSEGKADGATSDDLDLHDDRLSYLSAPGSE
YSMYSTDSRHTSDYEDTDTEGGAYTDQELDETLNDEVGT
PPESAITRSSEPVRED
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human,Mouse,Porcine,Rat

gene symbol :

TJP1

Antibody validation :

Biological Validation

applications :

Immunohistochemistry,Western Blot,Immunocytochemistry/ Immunofluorescence,IF/IHC,Simple Western,Immunohistochemistry-Paraffin

USD :

579 USD

alt names :

DKFZp686M05161, MGC133289, Tight junction protein 1, tight junction protein 1 (zona occludens 1), tight junction protein ZO-1, TJP1, ZO1, ZO-1, zona occludens 1, Zona occludens protein 1, zonula occludens 1 protein, Zonula occludens protein 1

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage