Tight Junction Protein 1 Antibody - BSA Free | Novus Biologicals NBP1-85046 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

Tight Junction Protein 1 Antibody - BSA Free

catalog :

NBP1-85046

quantity :

0.1 ml (also 25 ul)

price :

559 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section, immunohistochemistry - frozen section

more info or order :

Novus Biologicals product webpage

citations: 13

Reference
Han B, Lv X, Liu G, Li S, Fan J, Chen L, et al. Gut microbiota-related bile acid metabolism-FXR/TGR5 axis impacts the response to anti-α4β7-integrin therapy in humanized mice with colitis. Gut Microbes. 2023;15:2232143 pubmed publisher
Khan M, Clijsters M, Choi S, Backaert W, Claerhout M, Couvreur F, et al. Anatomical barriers against SARS-CoV-2 neuroinvasion at vulnerable interfaces visualized in deceased COVID-19 patients. Neuron. 2022;110:3919-3935.e6 pubmed publisher
Shastri S, Shinde T, Woolley K, Smith J, Gueven N, Eri R. Short-Chain Naphthoquinone Protects Against Both Acute and Spontaneous Chronic Murine Colitis by Alleviating Inflammatory Responses. Front Pharmacol. 2021;12:709973 pubmed publisher
Balzano T, Leone P, Ivaylova G, Castro M, Reyes L, Ramón C, et al. Rifaximin Prevents T-Lymphocytes and Macrophages Infiltration in Cerebellum and Restores Motor Incoordination in Rats with Mild Liver Damage. Biomedicines. 2021;9: pubmed publisher
Lensu S, Pariyani R, M xe4 kinen E, Yang B, Saleem W, Munukka E, et al. Prebiotic Xylo-Oligosaccharides Ameliorate High-Fat-Diet-Induced Hepatic Steatosis in Rats. Nutrients. 2020;12: pubmed publisher
Patterson L, Allen J, Posey I, Shaw J, Costa Pinheiro P, Walker S, et al. Glucosylceramide production maintains colon integrity in response to Bacteroides fragilis toxin-induced colon epithelial cell signaling. FASEB J. 2020;34:15922-15945 pubmed publisher
Ko S, Chen K, Wallace C, Yang C, Sung P, Shao P, et al. Protective effect of combined therapy with hyperbaric oxygen and autologous adipose-derived mesenchymal stem cells on renal function in rodent after acute ischemia-reperfusion injury. Am J Transl Res. 2020;12:3272-3287 pubmed
Shinde T, Perera A, Vemuri R, Gondalia S, Beale D, Karpe A, et al. Synbiotic supplementation with prebiotic green banana resistant starch and probiotic Bacillus coagulans spores ameliorates gut inflammation in mouse model of inflammatory bowel diseases. Eur J Nutr. 2020;: pubmed publisher
Sheu J, Sung P, Wallace C, Yang C, Chen K, Shao P, et al. Intravenous administration of iPS-MSCSPIONs mobilized into CKD parenchyma and effectively preserved residual renal function in CKD rat. J Cell Mol Med. 2020;24:3593-3610 pubmed publisher
Shastri S, Shinde T, Sohal S, Gueven N, Eri R. Idebenone Protects against Acute Murine Colitis via Antioxidant and Anti-Inflammatory Mechanisms. Int J Mol Sci. 2020;21: pubmed publisher
Evran S, Çalış F, Akkaya E, Baran O, Cevik S, Katar S, et al. The effect of high mobility group box-1 protein on cerebral edema, blood-brain barrier, oxidative stress and apoptosis in an experimental traumatic brain injury model. Brain Res Bull. 2020;154:68-80 pubmed publisher
Yip H, Chen K, Dubey N, Sun C, Deng Y, Su C, et al. Cerebro- and renoprotective activities through platelet-derived biomaterials against cerebrorenal syndrome in rat model. Biomaterials. 2019;214:119227 pubmed publisher
Shinde T, Perera A, Vemuri R, Gondalia S, Karpe A, Beale D, et al. Synbiotic Supplementation Containing Whole Plant Sugar Cane Fibre and Probiotic Spores Potentiates Protective Synergistic Effects in Mouse Model of IBD. Nutrients. 2019;11: pubmed publisher

product information

master code :

NBP1-85046

SKU :

NBP1-85046

product name :

Tight Junction Protein 1 Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The Tight Junction Protein 1 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to Tight Junction Protein 1. This antibody reacts with human,mouse,rat. The Tight Junction Protein 1 Antibody - BSA Free has been validated for the following applications: Immunohistochemistry,Immunohistochemistry-Paraffin,IF/IHC,Western Blot,Immunohistochemistry-Frozen,Immunocytochemistry/ Immunofluorescence.

target :

Tight Junction Protein 1

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

ASSQPAKPTKVTLVKSRKNEEYGLRLASHIFVKEISQDS
LAARDGNIQEGDVVLKINGTVTENMSLTDAKTLIERSKG
KLKMVVQRDERATLLNVPDLSDSIHSANASERDDISEIQ
SLASDHSGR
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human,Mouse,Rat

gene symbol :

TJP1

Antibody validation :

Orthogonal Validation

applications :

Immunohistochemistry,Immunohistochemistry-Paraffin,IF/IHC,Western Blot,Immunohistochemistry-Frozen,Immunocytochemistry/ Immunofluorescence

USD :

559 USD

alt names :

DKFZp686M05161, MGC133289, Tight junction protein 1, tight junction protein 1 (zona occludens 1), tight junction protein ZO-1, TJP1, ZO1, ZO-1, zona occludens 1, Zona occludens protein 1, zonula occludens 1 protein, Zonula occludens protein 1

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage