Myoferlin Antibody - BSA Free | Novus Biologicals NBP1-84694 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

Myoferlin Antibody - BSA Free

catalog :

NBP1-84694

quantity :

0.1 ml (also 25 ul)

price :

559 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

clone name :

NA1/34-HLK

reactivity :

human, mouse

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 6

Reference
Becker J, Schleinitz A, Hermsen C, Rappold S, Saftig P, Jeschke A, et al. Rab GTPase regulation of phagosome-lysosome fusion is bypassed in the presence of micromolar Ca2. J Cell Sci. 2023;136: pubmed publisher
Cruz P, Sosoniuk Roche E, Maldonado I, Torres C, Ferreira A. Trypanosoma cruzi calreticulin: In vitro modulation of key immunogenic markers of both canine tumors and relevant immune competent cells. Immunobiology. 2020;225:151892 pubmed publisher
Sugiura K, Wijewardana V, Fujimoto M, Akazawa T, Yahata M, Mito K, et al. Effect of IL-12 on canine dendritic cell maturation following differentiation induced by granulocyte-macrophage CSF and IL-4. Vet Immunol Immunopathol. 2010;137:322-6 pubmed publisher
Hirbod T, Bailey R, Agot K, Moses S, Ndinya Achola J, Murugu R, et al. Abundant expression of HIV target cells and C-type lectin receptors in the foreskin tissue of young Kenyan men. Am J Pathol. 2010;176:2798-805 pubmed publisher
Liu C, Wang Y, Lin C, Chuang T, Liao K, Chi K, et al. Transient downregulation of monocyte-derived dendritic-cell differentiation, function, and survival during tumoral progression and regression in an in vivo canine model of transmissible venereal tumor. Cancer Immunol Immunother. 2008;57:479-91 pubmed
Yoshino N, Ami Y, Terao K, Tashiro F, Honda M. Upgrading of flow cytometric analysis for absolute counts, cytokines and other antigenic molecules of cynomolgus monkeys (Macaca fascicularis) by using anti-human cross-reactive antibodies. Exp Anim. 2000;49:97-110 pubmed

product information

master code :

NBP1-84694

SKU :

NBP1-84694

product name :

Myoferlin Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The Myoferlin Antibody - BSA Free from Novus is a rabbit polyclonal antibody to Myoferlin. This antibody reacts with human,mouse. The Myoferlin Antibody - BSA Free has been validated for the following applications: Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Simple Western,Immunocytochemistry/ Immunofluorescence.

target :

Myoferlin

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

TIDLVIGYDPPSAPHPNDLSGPSVPGMGGDGEEDEGDED
RLDNAVRGPGPKGPVGTVSEAQLARRLTKVKNSRRMLSN
KPQDFQIRVRVIEGRQLSGNNIRPVV
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human,Mouse

gene symbol :

MYOF

Antibody validation :

Orthogonal Validation

applications :

Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Simple Western,Immunocytochemistry/ Immunofluorescence

USD :

559 USD

alt names :

fer-1 (C.elegans)-like 3 (myoferlin), FER1L3, fer-1-like 3, myoferlin, fer-1-like 3, myoferlin (C. elegans), Fer-1-like protein 3, FLJ36571, FLJ90777, KIAA1207, myoferlin

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage