Optineurin Antibody - BSA Free | Novus Biologicals NBP1-84682 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

Optineurin Antibody - BSA Free

catalog :

NBP1-84682

quantity :

0.1 ml (also 25 ul)

price :

559 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

clone name :

5G10

reactivity :

human, mouse

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section, immunohistochemistry - frozen section

more info or order :

Novus Biologicals product webpage

citations: 6

Reference
Zhi F, Li B, Zhang C, Xia F, Wang R, Xie W, et al. NLRP6 potentiates PI3K/AKT signalling by promoting autophagic degradation of p85α to drive tumorigenesis. Nat Commun. 2023;14:6069 pubmed publisher
Huang K, Gomes C, Shiga Y, Belforte N, VanderWall K, Lavekar S, et al. Autophagy disruption reduces mTORC1 activation leading to retinal ganglion cell neurodegeneration associated with glaucoma. bioRxiv. 2023;: pubmed publisher
Taira Y, Ikuta Y, Inamori S, Nunome M, Nakano M, Suzuki T, et al. The formation of multiple pituitary pouches from the oral ectoderm causes ectopic lens development in hedgehog signaling-defective avian embryos. Dev Dyn. 2020;: pubmed publisher
Gong M, Lugo Cintron K, White B, Kerr S, Harari P, Beebe D. Human organotypic lymphatic vessel model elucidates microenvironment-dependent signaling and barrier function. Biomaterials. 2019;214:119225 pubmed publisher
Smith A, Sewell G, Levine A, Chew T, Dunne J, O Shea N, et al. Disruption of macrophage pro-inflammatory cytokine release in Crohn's disease is associated with reduced optineurin expression in a subset of patients. Immunology. 2015;144:45-55 pubmed publisher
Sweat R, Sloas D, Murfee W. VEGF-C induces lymphangiogenesis and angiogenesis in the rat mesentery culture model. Microcirculation. 2014;21:532-40 pubmed publisher

product information

master code :

NBP1-84682

SKU :

NBP1-84682

product name :

Optineurin Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The Optineurin Antibody - BSA Free from Novus is a rabbit polyclonal antibody to Optineurin. This antibody reacts with human,mouse. The Optineurin Antibody - BSA Free has been validated for the following applications: Western Blot,Immunohistochemistry,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry-Paraffin,Immunohistochemistry-Frozen.

target :

Optineurin

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

LGIVSELQLKLNSSGSSEDSFVEIRMAEGEAEGSVKEIK
HSPGPTRTVSTGTALSKYRSRSADGAKNYFEHEELTVSQ
LLLCLREGNQKVERLEVALKEAKERVSDFEKKTSNRSEI
ETQTEGSTEKENDEEKG
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human,Mouse

gene symbol :

OPTN

Antibody validation :

Independent Anitbodies

applications :

Immunohistochemistry,Western Blot,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry-Paraffin,Immunohistochemistry-Frozen

USD :

559 USD

alt names :

FIP2FIP-2, GLC1Eglaucoma 1, open angle, E (adult-onset), HIP7ALS12, Huntingtin interacting protein L, Huntingtin yeast partner L, Huntingtin-interacting protein 7, Huntingtin-interacting protein L, HYPLHIP-7, NEMO-related protein, NRPE3-14.7K-interacting protein, Optic neuropathy-inducing protein, optineurin, TFIIIA-INTP, Transcription factor IIIA-interacting protein, transcrption factor IIIA-interacting protein, tumor necrosis factor alpha-inducible cellular protein containing leucinezipper domains

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage